Home About  Velankanni Location Map Church Timings
Apparitions of Mother Mary
Life of Mother Mary Prayers
                         Prayer Request to Our Lady of Good Health
History
About Church
Photo Gallery
Personal Experience
Testimonies
Prayer Request
Guest Book
 

 

 

 

 

 

 

 

 

 "If you can believe, all things are possible to him who believeth. Mark 9:23 "... Hence do not worry, the Lord God will surely hear our prayers through the intercession of Mother Mary..

SUBMIT YOUR  PRAYER REQUEST HERE

 


Deprecated: Function mysql_db_query() is deprecated in /home/content/32/6260132/html/velankannichurch.com/pages/prayerrequest/view.php on line 243

Deprecated: mysql_db_query() [function.mysql-db-query]: This function is deprecated; use mysql_query() instead in /home/content/32/6260132/html/velankannichurch.com/pages/prayerrequest/view.php on line 243

NamePrayerPlaceDate
jikku maathaavae... sorry....:( kerala 2014-07-25
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2014-07-25
Maria Ronald Dsouza pray for us .... i would like to inform you, (pls forgive me matha) when i was pregnent that time i promised to mother mary if everything will be fine i will come there with my child whithin one year to velenkanni, now he is 2 years 3 month old, my son name is AARON RONALD DSOUZA i can not come for some reason ,but my son again and again falling sick please pray for him heel him from all his sickness as soon as possible i will bring him there,pls pray for my child for his good health.thank you pls pls pls reply me. mumbai 2014-07-25
stephenC Dear People of God, I thank very much Jesus, Mother mai and you people of God for all the blessings and petitions received during the week and also please pray for my safe return journey. Thank you Jesus Praise you Jesus love you Jesus-servant of Jesus-stephen mumbai 2014-07-25
Benjamin Roy Velankanni Amme.......thank you for a nice home ,loving wife, loving son , business thank u for each and every blessings which you give in my life.....thank u .....forgive my sins,i am in very big financial crisis. please solve my all financial problems....praise the lord.....alleluia........ utter pradesh 2014-07-25
r mathave kathu kollane.koode undayirikkename amme. I pray for my stn transcript and refund amma. please be with me and help me amma. sc 2014-07-25
M.Rajendran amma ellam un vazhikattuthalpadiye nadakkattum. engal kulanthaikalai asirvathiyum. shosthirem Chennai 2014-07-25
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-24
kavitha henry Mother mary amma pls have mercy on me amma today my husband went to the bank the told that we will not give the loan for driving school amma what to do for that amma pls tel me some thing and do for mr some thing amma to get the money and to take the golds amma how much problem im having pls help me amma Pls pls i beg u pray for me with jesus christ to solve all my problems and to get good job soon amma with a good pay tge should not ask any certificate amma when i get the job pls be with me your seeing all my problems and leaving my hand amma pls help me no daddy is there for me to help amma sion i should get gud job amma pls pls beg u amma and bless my family and bless for my health that i should not put more weight amma specialy pray for the interest that i should pay soon amma amen. bangalore 2014-07-24
Krd Maa kindly show us a solution to our problem facing now. Pray for us to go everything smooth and fine without any complications. Maa please takeout the superstition from my son's mind that anything on his name will not give success. Be with us always. Love you mother. India 2014-07-24
Krd Maa please help my daughter in law to get a good job immediately. Mee sahayam kavali thalli. Job entho avasaram amma. Calls vasthunna interview varaku inka raledut. Ma kosam pradhinchandi thalli . Meeku Aneka kruthagnatha sthutulu. India 2014-07-24
Krd Maa please help my daughter in law to get a good job immediately. Mee sahayam kavali thalli. Job entho avasaram amma. Calls vasthunna interview varaku inka raledut. Ma kosam pradhinchandi thalli . Meeku Aneka kruthagnatha sthutulu. India 2014-07-24
alwin ps mathave enikkum ente sahodaranum hiv rogathil ninnum sowkyam nalkaname.amma isoyodu chodikkunnatellam avidunnu njagalku tharumennu enukku ariyam.amme enikum ente sahodaranum hiv ulla allavarku vediyim prarthikaname .amen irinjalakuda 2014-07-24
Carol Please pray for Anne,Mollyand Carol to have a safe trip to India and a Spirit filled retreat.Please pray for Tanya to have a safe journey to Sri Lanka and to return home safely.Thank you. Malaysia 2014-07-24
Carol Please pray for Anne,Mollyand Carol to have a safe trip to India and a Spirit filled retreat.Please pray for Tanya to have a safe journey to Sri Lanka and to return home safely.Thank you. Malaysia 2014-07-24
r kathu kollane mathave. koode undayirikkename amme. i pray that i get my refund and that i do very well in my exam.please be with me and help me with everything. sc 2014-07-24
M.Rajendran amma un thunai endrendrum vendum thaye. en kulanthaikalai asirvathiyum thaye shosthirem Chennai 2014-07-24
Binu Vela kanji amme, please heal my son Rohan from his illness. Please control his infection and provide a speedy recovery. I promise you that we will witness your miracle all through our life. Canada 2014-07-24
George Victor AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-24
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-24
Daniel Martin We want to sell our property which is located in Miraj, Maharashtra. As we want to build our own house in Pune by that money. We have some customer how have approched us for the property, however we have not heard from them, we are trying to sell this property since last 2 yaers , till now no response. please prayer for us so that some good customer can buy that property from and we can build our house. currently we are staying rent house. please prayer for us. Warm Regards Pune 2014-07-24
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVASHOULDBEAVVAALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAGOTAVVAAVVACOLDAVVAAVVANDAVVAAVVACOUGHAVVAAVVAAVVAPLEASEAVVAAVVADOAVVAAVVAMIRACLEAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAANSWERINGSAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAVVAAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAANDAVVAAVVACUREAVVAALLAVVAHEALTHISSUESAVVAANDAVVAALSOAVVACUREAVVAAVVATENSIONSAVVAAVVAAVVAITRUSTAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAANSWERINGSAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAAVVAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVA…… Bangalore 2014-07-24
Roche Victor Maria Doss Nandri Madhavee, Thanks a lot for blessing everyone in this world , Amen, Chennai 2014-07-24
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth and peace of mind and protect me from all evils,dangers and accdients.My saviour please dont let em down and mother mary i thank you for giving an increment of 11% ,this has happend only because of your blessings and grace and me and my family thnak you for this help and you ahev save me fromthe financial burden.My saviour please come to my aid and protect me and save my job ,please give me strenght and confidence to work hard more and pls give em engey and strength to fight agianst the office politics adn forgive me for been rude shoutign at my team adn other people.my saviour dont let me down.Mother Mary i respect your blessing and ur judgement ,you always think what is right for me adn my family.But mother mary save me job and humlition and insults and bless my relatiohsipw ith my CEO and my boss ,i odnt i always think wrong about her and i dont know wha tis reason for that.MOther Mary i haev cheated my team mate pls forgie me for that and i couldnt keep up my words and committment i gave to my team,i could only do godo for one team member. Mother Mary mys aviour you have always shown way for my life and have saved me fromall kinds fo problems and issues and i lack in confidence and i feel insecure and aloney ,everyday there is problems and issues.Mother Mary please bless all my indents to be approved by my CEO and my boss ,otherwise i cant execute this pending project pls and this mobiel phone issue is stillthere pls come to me and shwo me way for my life adn bless me so that i save more money and give a godo life to my family adnget back all my jewels and pay back my the loans .Pls bless all my friends adn loved onew with epace good health,and protect them from all issues and give them sucess.Mother Mary my saviour please save me adn give em strenght to answers all my CEO's queries and boss's problems.Please save my job ,my name adn dignity inthis compnay i always haev bad opinion about others that's reason my name is spoilt.MOther Mary pls coem to me and stay with me and guide me in proper way so that i lead decent and godo human being g and be good dispilice of lord jesus andtoday is my daughter's b'day pls belss her so taht she grows in good way adn with godo educitonad save her form all problems ,issues and forgie her sins.Mother Mary mysa viour dont let me down bless this b'day sot hat everythign goes well as planned adn show me and sucess in my career.MOterh mary another job is still on hold i dont know whether i'll get selected or not ,if selected i'll shave my head at your shrine.Mother Mary my saviour dont let me pls i need this job ,coem to me its big hotel adn well know brand its been two yrs iam not eben promoted and ther is insecure feelign and i dotn ave any rights for any things.Mother Mary please you know everythign adn its not that i have doen mistkes adn pls forgive me and i kneel before your shrine andbeg you to forgive me an save my job i need to stay atleast two to three yrs in delhi so that i can go abkc in decent way .Mother Mary mys aviour i beg you for everythign and pls give me peace of mind and strengh and forgie me thsoe who hurt me adn talk bad about me at my backa dn those who put me down in front of everyone.Mother Mary pls bless this day with epace of mind adn sucess and pls save me form this IPAD an IPHONE issues and i'll never do anythign without my CEO or boss permission.Mother Mary pls coem to me and be with me adn bless this hosue and protect it from alle vils,danegrs adna ccidents adn pls give sucess inthsi house.Mother Mary my saviour dont let me down. My job and my name and career is very improtant in my life and i need your blessings guidenance and protection n all my decsions .My work is my life and withotu this notign is possible in life adn withotu money huamns dont respect me. COme to me and bless me and my family and all myfroends adn loved ones. In your name am starting my day pls bless this day adn my daughte's b'day to go well. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,Virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatening dangers vanishes at thy prayer. Amen, RGds, J.Dominic Vijay Kumar Delhi 2014-07-24
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get a good house, good increment, good promotion. Mother please bless my dad of eternal peace. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health njob satisfaction. Mother please bless my family peace n happiness mumbai 2014-07-24
alice Dear mother Please pray for my sister-in-law Mrs. Celine DSouza 55 years. Her BP is gone very very high and Doctor told there are chances of getting heart attack. She is tensed and crying. Mother please grant her healing andheri east, mumbai 2014-07-24
Noel Mother Mary, Give courage and Good Health to my daughter to face her problems in life. Brahmavar 2014-07-24
kavitha rajan Praise the Lord, Today my father has gone to a Bank for settlement of our major long time ago loan. on saturday he has to appear in the court for the same. If today he gets a settlement letter from the bank, he can show the copy of the same in the court tomorrow. My father is a heart patient and is struggling very hard even at this age of 67 years. Pls pray that everything settles smoothly without any trouble. please give him mental peace and rest. yesterday he was not able to sleep at night because of this tension. Please pray that banker/court shows mercy on my father. MY FATHER'S NAME IS RANGARAJAN. PLS PRAY IN HIS NAME TODAY AND TOMORROW. Amen, Kavitha new delhi 2014-07-24
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless us get agood full time maid. Mother please bless my family peace n happiness. mumbai 2014-07-23
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child.Mother please less avi n me good health, make us peaceful,free us of all worries, help us in our job, help us get agood house,good increment. Mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness. mumbai 2014-07-23
SM Please pray thatLi and her husband and Lanell are at peace and do no fight or cause stress at home or work, that the house sale is done easily and also the dues are given to me immediately that RM will never give me any problem, for SS victory and good health and that the factory and shop sale happens immediately and easily and Smv is happy and for CRM's good health and for him to return the dues to me. M 2014-07-23
Renjith Philipose Dear Velankanny Matha, Many thanks for blessinging me with all necersities in various situation of my life. Please be kind to inteviene in finding a good bridegroom for my sister and bless her with a god fearing and blessed life partner that is best suited for her life by the will of your son and my lord Jesus Christ. Australia 2014-07-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope and Love. Please do not forsake my loved ones. Amen. -- 2014-07-23
viviana dsouza Mogal maie argam ditanv tuka soglea tujea deneapassot maie magtanv tuje lagim amchea financial situationan tum amkam pav ami zaite rinnan asatmaie tum amkam pav ani vegin farik korunk amkam kurpa dhi maie. India 2014-07-23
jomole Please help me in my problems.i am struggling too much mentally.why you are not listening my prayers and always giving me sorrows only.please open your eyes to my sorrows.please help me.U dubai 2014-07-23
anish ente mathave njangalude makale kathukollename kunnamkulam 2014-07-23
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma once again I thanks for hearing my prayer my loan been sanctioned, now ma I should get permission and booking to go town to sign the loan application ma.Ma I pray for my dad leg wound touch and heal his leg ma.Ma praying for my friend who work in our department nothing should go wrong against his job,protect him ma from all evils behind him and he should do well in his work and get good name ma show your miracle on him ma.Thank you ma. Auh 2014-07-23
anish mathave njangalude molku ayussum arogyavum kodukane kunnamkulam 2014-07-23
M.Rajendran amma unakku kodanukodi nandri. en kulanthaikalai nallapadiyaga oor poi sera arul purinthaai. aduthu naan edukkum nalla pani inithe niraivera un arulasi vendum thaye shosthirem Chennai 2014-07-23
M.Rajendran amma unakku kodanukodi nandri. en kulanthaikalai nallapadiyaga oor poi sera arul purinthaai. aduthu naan edukkum nalla pani inithe niraivera un arulasi vendum thaye shosthirem Chennai 2014-07-23
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-23
r kathu kollane mathave.koode undayirikkename mathave. i pray that my money gets refunded, my di today and my exam tomorrow.please be with me amma nd help me with everything. kathu kollane amma.koode undayirikkename amma. sc 2014-07-23
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-23
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child> mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless sort our family dispute. Mother please bless us get a good full time maid. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-07-23
Roche Victor Maria Doss Thanks madhavee, Thanks for blessing everyone in this world , Thanks for blessing my mother, Thanks for blessing my entire family . Amen Chennai 2014-07-23
Alex Me and my wife are seperated now for past 2 months, and we have a child who is 9 years old. Please pray to mother mary to help us in getting us together. Australia 2014-07-23
christy dear madhave, what all are i heard? dear ma help us to overcome all these roomers. dear ma how many people are saying like this. we cannot close the mouth of the village i know. but what is this dear. we are unknown about it even in our dreams. but its is heard now. dear ma help us to find new works. help us to success in life and our profession. help us to close such unwanted roomers. dear ma pray for us strongly to ur loving son. we are in a deep well we feel. dear ma help us help us hear the cry of your children. ngl 2014-07-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-07-23
carol Dear mother, I ask of you in faith to please bless my son help him to do well in his studies help him to get the job at the harbour merrioten help him to get his pr and work permit soon help him with good health. Thanks for all the favours received. mumbai 2014-07-23
p.vinothkumar ANNAI VELANKANNI MADHAVA MY MARRIAGE WAS DELAYED.PLEASE PRAY FOR MY MARRIAGE.YOU ARE MY WAY IN MY FUTURE.PLEASE ARRANGE GOOD FAMILY GIRL IN MY LIFE PARTNER.YOU ARE IN MY LIFE. I LOVED VERY MUCH YOU.MY MOTHER WAS WORRIED ABOUT MY MARRIAGE. MY AGE IS 28 YEARS OLD.PLEASE ARRANGE MY MARRIAGE VERY SOON. coimbatore 2014-07-23
Krd Maa we are in some problem regarding the new purchase of home. Kindly help us to go everything smooth in the process. Maa please pray for us and bless us. Meeku Aneka vandanalu chellichukuntanu thalli. Maaku Prathi vishayamlonu mee daya chuputhunnavu thalli. Enno kruthagnatha sthutulu Maa. India. 2014-07-22
Antony Dear Mother, I seek your help and blessing for me to have a child and to start-up and be successful in my business. Please pray for me... Chennai 2014-07-22
Leena Paul Dear mother, my husband and my brother have interview for getting better job. Mother Mary please pray for us for getting through the interview. Bless us and each one of my family members on each every second and also fill us with your peace and happiness. Mother please find the solution for Tom's job. Please give him better job with good package and bless his family from all worries. Australia 2014-07-22
Anon Blessed Mother Mary, ever virgin I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. --- 2014-07-22
vin dear mother mary, keep good and smooth delivery to my child and make sure this should happen on 27 July,I will do all kind of sacrifice to u.thanks pay for my family peace Chennai 2014-07-22
viviana dsouza mogall maie argam ditanv tuka soglea tujea denea passot maie ami zaitea rinnan asa maie tum amkam pav rakh ani sambhav tum maie amkam tem farrik korunk kurpa dhi maie maie zaite pavtim mhaka rag koso ieta ani magir hanv kitea uloita tem hanv noko zhodd korun hanv burgeacher chavota, toxench magtanv maie mhojea bhava passot tachea kallzan amcho mog ghal. amkam borea bholaiken dovor maie. India 2014-07-22
T JAYACHANDRA Mother of good health i surrender my brother T.Rajesh to your powerful intercession let mother your mighty presence save my brother from all the evil and make him as your son by your grace and show him right path and way for his future i beg you mother and lord almighty and lord jesus please kindly help my brother and take care about him. please mother you are the only way the truth and life for our family mother amen.let rajesh be your guided blessed son amen and save him from all the evil and from all the bad relation ships please save him and bless him amen hyd 2014-07-22
jomole Amma, please bless to get proper reply from doctor regarding the surgery of my son. Please help me in my present problem. Please bless us to go back immediately after completing treatment.please bless us with a reply tomorrow. kottayam 2014-07-22
jomole Amma, please bless to get proper reply from doctor regarding the surgery of my son. Please help me in my present problem. Please bless us to go back immediately after completing treatment.please bless us with a reply tomorrow. kottayam 2014-07-22
r kathu kollane mathave.koode undayirikkename mathave.father lord, lord jesus, holy spirit, st antony appacha, st jude appacha, kaval malakhamare, kanyattunirappu muthappanmare, appe kathu kollane. please help me get the job in october.please be with me and help me. sc 2014-07-22
Antony JM " OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma thanks for hearing my prayer.Ma today the bank which I applied for loan they called me that my loan been sanctioned,thank you ma for hearing your believer prayer and petition.Thank you ma..... Auh 2014-07-22
Family Hey Ma my loving mother plz cure the infant who is newly born plz bless him with good health so tht my bro and bhabi can spen much time with him plz bless both of them with happiness Love u ma Chennai 2014-07-22
Anthony Please prayer for me I'm going thought real hard times in my life. I'm in my 50s I use a walker to get around I want to walk with out my walker so I can move on with my life I have real bad anxiety Panic attack Depression. All of this causes me to lose my balance shake and sometimes fall And I get dizzy Praying for restoration my relationship With my true love Connie To get back together again To communicate With each other To be more closer with each other And for Connie to gain her trust back with me And the restoration of my health and well-being financial breakthrough to talk. An to Express myself an just Speak not be quiet. An I have Fears that are stoping. To Go forward in my life Thank you for your prayers Florida 2014-07-22
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-22
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVASHOULDBEAVVAALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAGOTAVVAAVVACOLDAVVAAVVANDAVVACOUGHAVVAAVVAAVVAPLEASEAVVAAVVADOAVVAAVVAMIRACLEAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAANSWERINGSAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAVVAAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…… Bangalore 2014-07-22
Rajiv @ Rubun Arokiasamy Ave Maria, Please take care of my family members . I become permanent employee of this organization ( Tata Consultancy Services Limited) Please take care of All the peoples in the worls. Mariapuram 2014-07-22
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-22
Roche Victor Maria Doss Nandri Madhavee, Thanks for this wonderful life, Nandri madhavee, Amen Chennai 2014-07-22
r kathu kollane mathave.koode undayirikkename mathave. sc 2014-07-22
kavitha henry Mother Mary pls have mercy on me amma pls help to get the loan from mahindra amma know only I will get 30 thousand amma even my husband should the loan amma I have kept the jewels for 1,63000 amma if I get 60 thousand and remaining it ill be 1 lack amma Pls help me to get the loan tomorrow amma I am going to bank tomorrow pls be with us amma soon I should get the loan tomorrow amma pls arrange me to get some more loan amma pls soon solve all my problems amma with out you no baddy is there for me that you no very well amma if I take out all Aunty's jewels than I'm free amma so only my golds live be there amma if any gives me the loan it I'll be very easy amma ..in the new mini motor driving school more and more business should happen amma pls help me amma if there is more business only I can solve all my problem soon amma before aunty comes from London I should give her back all the golds amma for that only your the person to give me the help and money amma main thing give me good business amma and give a good company amma I should join for the good company and good salary amma and I should get the job without any certificate and in koromangala r indiranagar amma pls bless me amma and my daughter should be very smart and good in studies amma she should learn nicely amma pls bless her amma and my should should active and he should do every soon amma bless my family and I should not put too much of weight amma pls bless me that I should be 55 kg and my stomach should go inside amma know my weight is 60 kg amma pls I should loss my weight amma help me and pls be with me amma all my prayer should come true amma pls pray for me with Jesus Christ amma amen. bangalore 2014-07-22
elza suja ente amme please help me to get a visa for housemaid and please help us to find a good house maid. amme sahayikkane. doha 2014-07-22
elza suja please help me to lead a joyful family life. keep einmentalpece and calm and quiet life. please helpy husband to nderstandand love me. amme help me. doha 2014-07-22
mm Ma Good Morning and thanks Ma. Ma pleae please protect and guide my daughter and take all her papers to the right hands and excell all her papers Ma. Ma please protect her from all evil doers, dangers of life dieseses and other calamaties. brign good groom for her ma. and bring good tenants and bring us f auh 2014-07-22
Sutapa Mondal My prayer request is to get married to the person I love (Binu Vaidyan) Mother please convince his parents that they agree to accept me as their daughter in law. Mother , you know my difficult situation. You know my mental condition. I am also without job for more than one year . Mother Mary please help me . Nothing is impossible for you . Please Mother do not let me loose faith in you. I trust you mother. Being my mother , please help me . I am going through this situation for a long period. Mother I pray before you with purity of my heart. Please MAA help me. Asansol 2014-07-22
maniyan paramasivam amma. i am am sorry for all my bad behaviors i did so far amma. i really sorry amma. be with me and bless me amma. i love you. i want you to be with me and bless me forever amma. make my mind so perfect and very brilliant amma. i love you.. i submitted my wants to you so far through this website amma. if i get all of my wants i will be good and i stop doing bad things amma. i love you. i just believe in you amma. you want me to be good. yes i will be good but the same time i should be how i want to be as my wants amma. i should be so fast and brilliant and accurate and correct amma. with your blessings maniyan paramasivam surat 2014-07-21
carmina Mother of God please ask your son our Lord Jesus Christ who will never say no to you, for anything you ask of him He grant your request believing in this I ask you Mother of God to ask my lord your son to bless my daughter in her career. to help her to start in UK by next month, that General Medical Council to accept her application and grant her permission to start her work by next month. Bahrain 2014-07-21
R.HARI Please bless my son R.HARI, give good health to him. R.HEMAVATHY, MOTHER Chennai 2014-07-21
R.HARI Please bless my son R.HARI, give good health to him. R.HEMAVATHY, MOTHER Chennai 2014-07-21
R.HARI Please bless my son R.HARI, give good health to him. R.HEMAVATHY, MOTHER Chennai 2014-07-21
Candiss thank you mother mary for all the blessings that you have showered upon shaynes family and my family. thank you to always taking care of us and being there with us in everything that we do. thank you for giving us a positive report about shaynes health. continue to heal him and may he get well soon.you have always been by our side and i know that you will never leave us. kuwait 2014-07-21
Prm Mathave please pray for the peace in our family.both my father and brother are not in good terms,because of that mother is also suffering,please transform them ,and make them loving people,please fill their heart with love,they should never fight again...please make us a blessed family..please take care of my moms health .please do a miracle velamkanni Mathave..I am thanking you for hearing my prayer and doing the miracle..I will come to velamkanni and pay my gratitude...thank u Mathave . Kerala 2014-07-21
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-21
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-21
r Mathave,thank you so much for your love and kindness.Thank you for being my mother eternal. Mathave, I pray for your help with msaoburi. Please forgive me for my sins, please forgive me for being arrogant and not praying to you last night and missing my prayer request. I part amma for calls to cp and ici.mathave, please please please help me.father lord, lord jesus, holy spirit, st antony appacha, st jude appacha kathu kollane, kanyattunirappu muthappanmare, appe, kaval malakhamare kathu kollane.koode undayirikkename. sc 2014-07-21
Mary Help me to forget the person i loved the most Mumbai, India 2014-07-21
jomole Amma, Please give me a solution for the problem facing.please touch the doctor and l beg your powerful intercession to get aproper reply regarding the surgery of my son.pleae give a immediate recovery.please bless to rejoin in my job after surgery. dubai 2014-07-21
jomole Amma, Please give me a solution for the problem facing.please touch the doctor and l beg your powerful intercession to get aproper reply regarding the surgery of my son.pleae give a immediate recovery.please bless to rejoin in my job after surgery. dubai 2014-07-21
M.Rajendran amma nallapadiyaga kulanthaikal poi sernthathu kuritha thagaval thamathamindri varavendum. shosthirem Chennai 2014-07-21
ARUNA SIVASAMY Dear Mother Mary i seek your blessings to be bestowed on my Mother - Aruna Sivasamy who is suffering from severe Arthritis and Rheumatic pain in her whole body, she cries in pain and we as her children feel very bad and worried for her aches and pains,we love her very much and very deeply care for her well being and speedy recovery, she has very recently undergone a blood test to test and rule out any adverse and serious problem related to bones and joints which might cause chronic illness. we all are really worried about test result, we request for prayers to mother Mary for the clear test report and rule out adversities in the test report. dear mother Mary we the children pray to you almighty and beg your blessings and miracle to be bestowed on our mother forever and keep her hail and healthy always and cure her from her pain. once again we the children beg with folded hands and pray to mother mary for her blessings to our mother. Children, ganeshkumar, Dineshkumar, Ankita Kumar, Tresa Dinesh Dubai, UAE 2014-07-21
mahesh Dear amm please bless my family.give good health to vijaya kanna rishika amma and nann.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-21
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma here I pray for the loan to be sanction.Ma show your miracle to get this loan and close the high interest credit and buy land.Ma please help us to get this loan and full fill our needs.Thank you ma. Auh 2014-07-21
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVASHOULDBEAVVAALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAUSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…… Bangalore 2014-07-21
Roche Victor Maria Doss Thanks mother mary , Thanks for blessing us with this wonderful life , Thanks for giving us the holy spirit , Thanks for blessing every one in this family , Nandri Madhavee, Amen. Chennai 2014-07-21
M.C Dear People of God, please pray to Jesus that R should come and go silently without creating any trouble. Thank you Jesus Praise you Jesus Love you Jesus.Servant of Jesus m 2014-07-21
mm Ma Good Morning Ma and thanks for all your blessings. Ma please help my daughter to pass in all her papers and excel in all her papers. help us to pay the rent and bring good tenant. Thanks Ma auh 2014-07-21
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-21
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth,peace of mind and protect us from all evils,dangers and accdients and forgive our sins and forgive thsoe who sin agaisnt us.Mother Mary i thank you for giving me another day in my life and for my family also,bless me with sucess and prosperity and give me strenght,confidence to work hard and answer all my CEO's queries and save my job,name and dignity inthis company and mother mary please take me out from all problems issues and pls give m peace of mind adn bless me with concertration and vision in life.Bless this day with peace sucess adn prosperity in life for me and dont let me down ,bless my relationshipw ith my CEO.my boss adn my team members and give godo leadership like St.Joseph who had taken care of his family in very godo way adn was alway workign hard.MOther Mary in your name am startign my day and this week ,please bless me so that interview with the new company get htro ,ineed this job very urgently mother mary please bless me and i need this job ,pls coem to my aid and shwo em way for all my probelms ,today am here its only because of you adn yoru blessign ,forthat me adn my family are so grateful loayl to you ,my saviour savemy job adn protect me from gettign insulted or shoutign from my CEO or my boss.Mother Mary i haev been shortlisted ,now its with th owners pls shwo me way for that and if you bless me with this job ,i'll get promtiom job with better salary ,and there is garranty of two witht he company,my saviour dont let me down pls i beg i haev promised to do that offering's when ge thtis job.MY saviour save me and my job and me fortmeh legal case so that i work and take care of my family.Pls bless my wife's jewels so that i dotn lose them.Pls in your naem only i satrt my day adn all my things. COem to me adn show me way for my problems adn pls give me good healt so taht i can keep my family secured adn happy. Mother Mary bless all my IT things so that nothign goes wrong,i feel ver insecured in my job and my life pls give me strength adn confidecne to fight agaist all odds adn save my job and give peace adn presence of mind . In your naem am startign my day pls bless me adn protect me from all evils and dangers adn humiltaion adn insutls. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-07-21
Utpala Mother m getting married with your grace, mother m going to marry only once in my life n hence want to marry with person who is good for me, pl mother bless me with this blessing. Mother till now I have lived happy life with my parents I request to give me happy life in future also with my husband. Mother, pl bless both of us that whatever qualities is required to run a happy married life let both of us have that so that we can live happy, satisfied married life. Mother pl shower your grace in our marriage n let your blessing be with us throughout our life. Mother pl bless us & my family Mumbai 2014-07-21
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get a good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good house n job satisfaction. mother please bless my family peace n happiness. mumbai 2014-07-21
rachael roy Maa bless my son bless my family,maa please help us maa we can't see any way.maa it's all up to you maa please help my husband protect him maa.please maa do something the day is comming soon maa please help us.maa sorry for what ever promises we had done and not stood.please ma forgive us and help us maa please maa show way to my husband. Maa help us maa kolkata 2014-07-21
Shirly This prayer request is for Shirly, Holy Mother , Please pray for the healing of shirly's skin rash and itching on her face and hands and body. Thanks for praying for me Shirly usa 2014-07-20
RODNEY ALBERT PLEASE PRAY FOR MRS. RUTH STEPHEN WHO IS SUFFERING FROM DIABETES. THE DOCTORS HAVE GIVEN UP ALL HOPE. PLEASE, MOTHER OF VELANKANNI HEAR OUR HUMBLE REQUEST AND GRANT HER THE COURAGE TO BEAR THE PAIN AND GET WELL SOON. THANK YOU Bangalore 2014-07-20
shinu Mother Mary we thank you for all the favors recd.Keep us safe in your hands as always.We need you blessing as long as we live & your faith will keep us intact. We pray for all those who are suffering from mental & physical pain.Help them with your faith & lead them in your way.We commit all our reqt. in front of you .We pray for all mankind & their good health.Amen Bhopal 2014-07-20
SANTANA BOSE Ma i have problem with my stomach i can't eat nothing if i eat anything a pain start inside my stomach due to this problem i am suffering from fobia nor i can go to outside nor i can stay in home maa please help me out of this problem earlier i have prayed to you about my leg problem maa you are miricale my leg problem has gone maa only you can help me please help me to out of this problem KOLKATA 2014-07-20
Anon Blessed Mother Mary, ever virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-07-20
BEAULAH DEOTARASE SHE IS SUFFERING FOR THE PAST SO MANY MONTHS FROM DIABETES AND HUGH BLOOD PRESSURE AND HER RIGHT HAND IS PARTIALLY PARALYZED. SHE IS NOW ADMITTED IN THE HOSPITAL MOTHER OF VELANKANNI PLEASE PRAY FOR HER THAT SHE GETS WELL SOON WITHOUT ANY MORE COMPLICATIONS. THANK YOU MOTHER MARY Dubai 2014-07-20
LEENA RODNEY MOTHER MARY PLEASE TOUCH HER MOTHER AS HER LEG IS SWOLLEN AND PUS IS OOZING. PLEASE ALSO PRAY FOR THE GOOD HEALTH OF BOTH OUR CHILDREN JOEL AND NADINE Bangalore 2014-07-20
rosely ouseph Dear Mother Mary please pray for me and my family.My son searching a rental house with furnished,ma please help him.Please give us good health and wealth,forgive our sins.Oh Jesus have mercy on us. kerala 2014-07-20
r kathu kollane mathave.koode undayirikkename mathave. i have my talk with t now.please make it go well.kathu kollane mathave. sc 2014-07-20
Violet Daniel Lord I pray for Daniel. He is going for angiogram today. He did his angioplasty in 2005 in the main artery and he has a stent. Please Lord let there be no more new blocks. Lord let his main artery that he has a stent be clear. Cover him with your blood Lord. Our daughter is going for her exam today. Please let her pass her exam by your grace. She just banged the car. Thank you Lord for protecting her and keeping her safe. Lord please help us in our financial problems. We don't know how to make payment for the hospital. Thank you Lord for all your blessing. Be with Lord Jesus. Malaysia 2014-07-20
Violet Daniel Lord I pray for Daniel. He is going for angiogram today. He did his angioplasty in 2005 in the main artery and he has a stent. Please Lord let there be no more new blocks. Lord let his main artery that he has a stent be clear. Cover him with your blood Lord. Our daughter is going for her exam today. Please let her pass her exam by your grace. She just banged the car. Thank you Lord for protecting her and keeping her safe. Lord please help us in our financial problems. We don't know how to make payment for the hospital. Thank you Lord for all your blessing. Be with Lord Jesus. Malaysia 2014-07-20
jomol Please bless my son to cure his foot problem.please bless get proper reply from doctor regarding his surgery. Bplease bless me and son to go back next month after treatment.you know my financial difficulties.hgeryence please bless us to get a surgery date from doctor. kottayam 2014-07-20
jomol Please bless my son to cure his foot problem.please bless get proper reply from doctor regarding his surgery. Bplease bless me and son to go back next month after treatment.you know my financial difficulties.hgeryence please bless us to get a surgery date from doctor. kottayam 2014-07-20
jomol Please bless my son to cure his foot problem.please bless get proper reply from doctor regarding his surgery. Bplease bless me and son to go back next month after treatment.you know my financial difficulties.hgeryence please bless us to get a surgery date from doctor. kottayam 2014-07-20
jomol Please bless my son to cure his foot problem.please bless get proper reply from doctor regarding his surgery. Bplease bless me and son to go back next month after treatment.you know my financial difficulties.hgeryence please bless us to get a surgery date from doctor. kottayam 2014-07-20
rachael roy Maa thank you for david da had replied to my husband,maa bless my family .maa please help my husband to come out of all the problems.maa i blieve you and i know will do some thing.maa help us .blesd this universe. Amen kolkata 2014-07-20
Sushma Pl.pray for my son Vicky to get a god selected life partner.gen.2:18.mom Trivandrum 2014-07-20
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensions and stress I an bearing now , mother please help me, mother as I am not feeling well suffering from severe wheezing , mother in am unable to breathe , i have no strength to do any work mother , and i have a small child to take care of, mother mother please help me mother , mother please heal me mother mother have mercy and heal me mother , mother do miracle and heal me mother , heal me totally what ever bothering me , and bless me with good health peace and happiness forever,mother please come into my life now hold me heal me change me and strengthen me mother, mother I beg you mother please come to me now i need you mother , please help me mother, mother please always be with us mother , mother please help me mother ,mother please help me mother and please hear my cry now mother and please grant my prayers now mother and please answer to all my prayers now , mother as u know due to my marriage issue my dad left me and restricted my mom and all my family not to keep any contacts with me, mother please soften my dad heart now and please let him accept me my husband and .my child and allow my mom and all my family to keep Co tracts with me , mother please reunite with my parents and home and bless Me and all my family with good health peace and happiness forever amen. Mother I beg this and I pray this in your name mother amen. bangalore 2014-07-20
anish ente mathave ente kudumbatheyum enneyum anugrahikename.ente prasnangal theerthu tharename .ente makaleyum kathukollename . kunnamkulam 2014-07-20
HH Dear Our Lady of Velankanni, I ask you to please heal my pains and end my streak of ill health. Please rid my of the cysts in my ovaries, cells continue to be normal. The persisting neck pain to be gone and my neck to function normally. For my mental health - the unruly and mean thoughts to vanish and disappear and mind to be at peace. Please help me Our Lady. Australia 2014-07-20
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHHAVVAAVVAAVVASHOULDBEALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA…… Bangalore 2014-07-20
lavi Mother mary pray for me.amen uae 2014-07-20
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-20
jomol Amma, Please help me in my needs.you know my needs.please help me.please bless my son to heal his clubfoot problem and walk properly.please bless the doctor to givea surgery date in the next appiontment.l promise i will bring my son to your foot. Please help us in my financial problems dubai 2014-07-20
jomol Amma, Please help me in my needs.you know my needs.please help me.please bless my son to heal his clubfoot problem and walk properly.please bless the doctor to givea surgery date in the next appiontment.l promise i will bring my son to your foot. Please help us in my financial problems dubai 2014-07-20
jomol Amma, Please help me in my needs.you know my needs.please help me.please bless my son to heal his clubfoot problem and walk properly.please bless the doctor to givea surgery date in the next appiontment.l promise i will bring my son to your foot. Please help us in my financial problems dubai 2014-07-20
jomol Amma, Please help me in my needs.you know my needs.please help me.please bless my son to heal his clubfoot problem and walk properly.please bless the doctor to givea surgery date in the next appiontment.l promise i will bring my son to your foot. Please help us in my financial problems dubai 2014-07-20
Roche Victor Maria Doss thanks Madhavee, Thanks for this wonderful life , Thanks for blessing my entire family , Amen Chennai 2014-07-20
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries help us in our job, help us get a good house, good increment, good promotion, good full time maid. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless US SORT Our family dispute. Mother please bless my dad eternal peace. Mother please bless my family peace n happiness mumbai 2014-07-20
stephen C Dear People of God, please pray to Jesus to bless my work for this week with no interference from any other depts. Thank you Jesus Praise you Jesus love you Jesus.Servant of Jesus -stephen Mumbai 2014-07-20
stephen C Dear People of God, please pray to Jesus and Mother Mai to bless my work for this week with no interference from any other depts. Thank you Jesus Praise you Jesus love you Jesus.Servant of Jesus -stephen Mumbai 2014-07-20
J.Dominic Vijay Kumar Dear Mother Mary, I dont what to ask you ,my saviour my job and name is such bad shape all my projects which i wa suppsoe handle is moved out ofmy hand adn given to soem one,looks like the compnay doesnt want me any more,mother mary i trus tin my prayers and rossary an your mircalse and you haev saved me from ao much of problems issues and saveed my life,now why am i going thro so much of problems,tension and my compnay and my CEO has lost trust in me and my work ,what all hard work and your blessings has gone in vain ,mother mary i donthave job now so that i can shift if they go ,mother mary i feel i should move out now as there is no more respect for me in this compnay,mother mary before they say go or throw me out pls get me job and save my family from coming on roads and i dont wnat go abckt o bangalore for next 2 to 3 yrs ,please save me come to my aid adn give peace of mind ,sttenght and confidence to overcome all my issues and problems.MOther Mary my saviour help me i have givene me everyting but my job is always in insecure way adn what ever i do is goign in vain and i wsa told that i haev been shortlsited inthe last interview,now the owners have to decided who will they take,please mother mary mys aviou please help me ge thtis job ,as i haev promised i'll get my head shaved adn kneel and come to your holy tank,pls i beg you and fall at ur fet my saviour i need your blessing and these days am gettign such bad dreams i cant image pls save me adn my family.My daughter's b'day is on 25th of july pls bless that day so that everythign goes as planned and with out any problems ad office tension and from 1 to 5th of august iam in blr to take my wife's jewels ,so please mother may i need your blessing so that i do all the work which pending and come abck adn join my work,during that time pls protect my job and give me peace of mind and bless me so that what work i am suppsoe to do should go on well withotu any problems.Mother mary my saviour help me work hard and my left eye is creating soem problems ,pls they say its bad omen,my saviour all my problems i haev palced it at ur feet for survial its left to protect me or leae on road with my family.My saviour this job is given by you pls come to me and forgive my sins and forgive thsoe who sin agisnt us and bless all the families and friends who have helped to me to reach this position . I dont even know whether am promoted or am i getting an increment ,everythign is in dark. Please bless this day and this week with sucess adn prosperity so that i can work hard and stay inthis company till iget new job.Pls bless my relationshipw ith my CEO/my Boss adn all my team members and psl forgive me for being rude aggraont and slefish. O Mary ,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatening danger vanishes at thy prayer. Amen, Rgds, J.DOminic VIjay Kumar Dehradun 2014-07-20
deepik mother please help me to get a project in mepz itself.i am jobless for a long time. chennai 2014-07-20
MANIYAN PARAMASIVAM AMMA. I AM EXTREMELY SORRY FOR ALL MY BAD BEHAVIORS AMMA. AMMA. I AM TELLING IF I GET ALL OF MY WANTS I WILL STOP DOING ALL THESE BAD THINGS AMMA. BE WITH ME AND BLESS ME AMMA. I WANT YOU TO BE WITH ME AND BLESS ME ALWAYS AMMA. I SUBMITTED MY WANT TO YOU THROUGH THIS WEBSITE AND ASKED YOU AMMA. I HOPE I GOT ALL OF THEM AND I WILL BE GOOD AMMA. AMMA. I THREW MY BAD THINGS AND I STOP DOING THESE BAD THINGS WITH THE BELIEVE THAT YOU HAD GIVEN ME ALL OF MY WANTS AMMA. I LOVE YOU AMMA. PLEASE DO NOT TAKE YOUR LOVE FROM ME AMMA. SHOW THE MIRACLE OF I GOT ALL OF MY WANTS AND BEING NO.1 MEDICAL PHYSICIST IN THE WORLD. GIVE ME THE CONFIDENCE, LUCK, TALENTS, BRILLIANCY, HARD WORKING, I LOVE YOU. WITH YOUR BLESSINGS MANIYAN PARAMASIVAM SURAT 2014-07-20
henry mother mary please bless my family with good health & happiness. my office should get good number of admissions this month . i should get good collections. we should take out all the golds that we are pledged for this business. i should not have any health problems. please bless us. bangalore 2014-07-19
JENNIFER Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peacefuland normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get a good house, good increment, good promotion. mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please bless us get agood full time maid. Mother please bless my family peace n happiness. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. mumbai 2014-07-19
Anon Blessed Mother Mary, ever virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2014-07-19
kavitha henry Mother Mary pls bless my family amma .pls cure my daughters hurt soon amma her face got spoiled amma every thing her skin should be normal amma pls bless her and be with her amma pls always be with me and my son for every thing amma bless them amma Pls bless my office and to get more business amma so Mich problem I am having amma I am not able to pay the monthly interest also amma pls help me and love me amma pls some one should help me for the money pls from ur side you arrange amma for me for the money amount amma pls amma bless Pls bless me and help me for the health amma I should be only 55 kg amma know I am 65 kg amma I am only 26 years old amma I am having 2 kids amma pls bless me and I should not put more weight amma I have lot of problem amma period and stomach is too big amma pls help me pls aamma and my daughter and son should be study nicely amma pls both should be king in the study's amma y means I have not study but my aim is both the children should be smart amma pls always bless them don't leave there hand for any cost amma. And I should get a good job amma soon with out any certificate and in a good company with good salary amma and I want holiday in Saturdays amma pls so I can sit in my office when my husband goes to RTO office amma pls bless us amma having lot of credits amma 8 laks credit amma pls bless me amma this is my prayer pls listen to my prayer and pray to Jesus Christ amma amen. bangalore 2014-07-19
sajin pls gave her protection,compassion,peace and love balaramapuram 2014-07-19
jikku ammae mathaavae,,,, :( kerala 2014-07-19
r mathave.kathu kollane.koode undayirikkename .please please please help me with super2lao. sc 2014-07-19
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma today I said my 2nd week novena ma.Ma during these novena I pray to buy land for that we should get loan ma please help us ma.Ma also praying for my elder daughter stomach pain,touch and heal her ma show your miracle on her ma.Ma also praying for my father leg wound to be heal.Thank you ma. Auh 2014-07-19
baiju joseph my valankanny amma pls help me my land sale and give me good staf good business all my problem solve amma kottayam 2014-07-19
ravhael roy Maa bless my child and my family,maa bless this universe.Maa again my family my husband is in a very big trouble,last time only you saved us maa and today i blieve that only are goimg to take us out from this problem.Maa i thank you thank you lat for all thing for what ever you have given us,maa please save us help my husband maa i beg you for this problem.maa please help us and turn this impossible things into possible.I blieve you maa .Maa please let agree the person from whom we are going to ask about money,maa please help us our family needs you maa.Please listen to my prayers maa and forgive me for anything wrong if i have done. kolkata 2014-07-19
rachael roy Maa bless my child and my family,maa bless this universe.Maa again my family my husband is in a very big trouble,last time only you saved us maa and today i blieve that only are goimg to take us out from this problem.Maa i thank you thank you lat for all thing for what ever you have given us,maa please save us help my husband maa i beg you for this problem.maa please help us and turn this impossible things into possible.I blieve you maa .Maa please let agree the person from whom we are going to ask about money,maa please help us our family needs you maa.Please listen to my prayers maa and forgive me for anything wrong if i have done. kolkata 2014-07-19
rachael roy Maa please bless my maa and baba maa please bless our family from all worries.maa bless my husband for his work,maa please bless him.maa we are tiered of all the lenders maa please help us and bless us to get out of it.maa how ever we have to pay money to tojo daa's father by 7th of august maa help us maa help please maa we are loosing all hopes please maa don't let us loose our hopes maa help my husband maa help us bless us that i can admit in st. Anthony school in december.maa help us maa koljaya 2014-07-19
rachael roy Maa please bless my maa and baba maa please bless our family from all worries.maa bless my husband for his work,maa please bless him.maa we are tiered of all the lenders maa please help us and bless us to get out of it.maa how ever we have to pay money to tojo daa's father by 7th of august maa help us maa help please maa we are loosing all hopes please maa don't let us loose our hopes maa help my husband maa help us bless us that i can admit my son in st. Anthony school in december.maa help us maa kolkata 2014-07-19
rachael roy Maa please bless my maa and baba maa please bless our family from all worries.maa bless my husband for his work,maa please bless him.maa we are tiered of all the lenders maa please help us and bless us to get out of it.maa how ever we have to pay money to tojo daa's father by 7th of august maa help us maa help please maa we are loosing all hopes please maa don't let us loose our hopes maa help my husband maa help us bless us that i can admit my son in st. Anthony school in december.maa help us maa . Amen kolkata 2014-07-19
SM Please pray that me, CSM and Mini are healed immediately. Please pray that Liya calms down and never fights at home henceforth and that sh is ale to leave to be with her husband immediately and that the marriage takes place after three weeks and I get the dues from CRM at the same time with ease.Please pray that Susan has peace at work and good health also that SMV is peaceful and happy and really loves me, that Lan cannot anymore stress SS also that Alensa gets good grades. M 2014-07-19
pirfa wilfred kumbin pray to God to destroy all the forces against my life, destiny and future. plateau state, nigeria 2014-07-19
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-19
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.thankyou amma for the journey.bless prawn pond amma.give me job amma.thankyou amma. varahapatnam 2014-07-19
sreedevi mother i am very sorry i did not visit your shrine after i received your blessings. i will soon visit. mother, meanwhile, another difficulty has cropped up. my husbands eye problem may need a brain surgery. please mother have mercy on us and see to it that the problem resolves without surgery soon. o kind mother grant this wish and grant him allover health. i believe you immensely. show mercy on us mother we pray you. bangalore 2014-07-19
Krd Maa please help my son to get out of the problem. Theliyakunda gani telisigani mistakes chesi vunte mammalini kshaminchandi thalli. Meeku enno kruthagnatha sthutulu amma. India 2014-07-19
mm Ma Good Morning! Thanks Ma for all your blessings and graces and protection. Ma now i humbly and urgently ask you to please take all my daughters papers to the right hands and excell her in all her papers. Ma, please bring us good tenants and financially help us from this crises. bless all our near and dear once and bless spritually and materially. Thanks Ma. auh 2014-07-19
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2014-07-18
suba Dear Matha, please pray for my mother she is suffering from knee pain for past two years, now her condition become worst. She cannot walk as normal for long time. please pray for her to your son Jesus to recover soon and to walk as normal. Rangiyum 2014-07-18
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child> Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion, godo house. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please free avi n me of allworries n tension. Mother please bless avi n me of good health n job satisfaction.Mother please bless my family peace n happiness mumbai 2014-07-18
jikku ammmae... maathaae... ariyilla ammae.. am totally disturbd..... hmm... am feelin very much sad.... :( kerala 2014-07-18
R. Maha lakshmi AMMA MATHA VANDANAMULU, PLEASE HELP ME ANDARU BAGUNDALI, AMMA MA KU FINANCIAL PROBLEMS SOLVE AYATATU DARI CHUPU. AMMA MA HUSBAND HEALTH BAGUNDALI, NA DAUGHTER EDUCATION AND HEALTH LO TODUGA UNDU AMMA. PLEASE HELP ME, SAVE ME. Bholakpur, Secunderabad 2014-07-18
Ajo Velankanni mathave, I am thankful to Mother Mary for interceding in our prayers . Jesus has granted our prayers. Thank you Mother Mary for being with us every moment ,helping and guiding us. Mother with great joy I got a new and good job after 6 months. Thank you mother. Only by mother's intercession and blessing everything went on smoothly. Mother please do something about our FSW application. We are still waiting for a positive result,with your special intercession only this could happen. Mother be with us. You are our only hope. Please bless us, my wife who is carrying our babies and other family members, freinds with peace and happiness in future also.Thank you so much.Mother,I will visit Velankanni Churh next month. Bangalore 2014-07-18
stephen C Dear People Of God, I thank very much Jesus, Mother Mai and you people of God for all the blessing and petitions received during this week and for your prayers. Thank you Jesus praise you Jesus love you Jesus. Servant of Jesus-stephen Mumbai 2014-07-18
MBV Dear Mother, Please pray for US - my elder son (Krish) is suffering from hearing loss, please grace him so that he can hear just like a normal child without any Hearing Aid or Operation and my younger son (Kush) is not able to speak properly even though he is 2.11 Years Old also please grace him so that he can speak properly. Please bless both of my children. Vapi 2014-07-18
Mishal Dear Velakanni Mai, I am praying for my sister. You know what is best for her. Please shower your blessings on her and all of this derailed world . Please bless her with good future and guide us all your children onto the right path. Please have mercy on us all. Forgive us all. New Delhi 2014-07-18
rosely ouseph Our Dear Loving Mother Mary,please pray for my family, my children Jorly Reshma And their daughter from all evils and enemies,get them good health and wealth,wisdom,love and God's grace family life.My daughter Jyoti and her husband Babu their son Ashwin will also get God's grace family life.I also beg you that I and My Husband will also get good health and a loving family life.Please forgive our sins have mercy on us Jesus. kerala 2014-07-18
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-18
2014-07-18
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond .bless journey amma.give me job amma.thankyou amma. varahapatnam 2014-07-18
Roche Victor Maria Doss Nandri Madhavee, Thanks mother for blessing everyone , Amen Chennai 2014-07-18
r mathave kathu kollane koode undayirikkename.please find me an excellent person for 154 soon.kathu kollane amme. sc 2014-07-18
jojibabu amma mother i beg t u amma in the name of jesus christ i beg tu amma ur wish amma not my wish amma please forgive my sins amma in the name of jesus christ i beg t u amma who r asking prayer support amma i submit amma who r pary for me amma i submit ur loved foots amma mother today my sister birthday amma please bless her family members amma give good health and children education amma i beg t u amma tomorrow my son birth day amma please amma i beg beg beg beg beg beg t u r loved foots amma nee sevaku ennuko amma amma please bless give good health amma study gnamu amma prasadinchu amma i submit who r celebrate tomorrow birthday i submit amma all childrens parents health finacial family probulems amma i beg t ur loved foots amma ,vizag cite registration ni kuda nee padala daggar asubmit chesttunnau amma lot of people waiting amma n wife job ni submit chesttunnau amma akkada atamospiere ni amma bless cheyyi amma na job ni na coluges job ni submit chettunnau amma salary hike cheyyi amma ur wish amma house leka badpade varini submit chesstuunanau amma nenu vuntunna house lo inka 2yeras vunde bagyem prasadinchu amma na finacial probulem s amma ur wish amma nenu house purchase chesi bagyem prasadinchu amma i beg beg beg beg beg beg beg beg beg beg beg beg tu amma i submit my parents releatives amma old age people amma beg beg beg beg beg t u amma ur wish amma amen. in the name of jesusu christ i beg beg beg beg t u amma amma amen. hyderabad 2014-07-18
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth,peace of mind and protect us from all evils,danegrs and accdints and forgive our sins and forgive those who sin aginst us.My sviour i'll be travelling to banaglore on 1st to 4th fo August 2014,to take my wife's jewels out so that atleast some jewels come otu with saving i have done.My saviour please save my jewels i need that and its my wife's jewels she has given me when i wan in problems and please forgive me for my sins and for the bludner i had done in my life,my saviour please coem to me adn give strenght and confidence to work agaisnt all these things adn give us peace of mind and guide me to take right descions and help em overc oema ll my problems.Mother mary my CEO is back in town from today on wards ,i dont know his mood and plese bless my relationship with him and my boss ,i have no clue on my apprisal and increments and promotion ,things have changed now not like before i dont you will be right judge to give me what i desver and you know what i want,so mother mary it's left at your feet for showoing me right way adn bless me to lead ecent life like others and work hard and sve money for my future and save my wife adn daughter froma ll kind problems adn give em happienss and pece in life.my daughter's b'day in on 25th of July pls bless her and give are all the happiness and godo education and protect her from all issue problems and dangers.Mother Mary bless her b'day so that everything goes well as per her wishes and plans.My saviour we need you and we thanks for all the blessings you haev should on us and blessed us with such good job.Mother Mary my sa viour save my job and the problems i am going thro and if my CEO coems to know about hte IPAD my job is lost adn i dotn have anyother job to surve,mother mary you know all my probelms adn pain am goign the humliationa dn insults what is doen to me ,i know i haev doen so much of mistakes in life adn please i beg you frgive me for abusing my team people around me and gie good health,mental strenght and bless me with good leadership qualiteis and give me strenght to control my ego,anger and arrgance.Mother Mary bless all my IT ifnra adn bless these pendign projects to get over during the time given to us adn pls save my job and name and dignity in this company and bless all my things and my job.Mother mary there are no new openening coming up and adn am really worried if something happens to this job what willhappen to me adn my family ,i'll be on roads.Mother Mary please show me way adn gudie and work hard.Mother Mary this week as of now has gone in good way adn bless this day and the weekw ith sucess adn peace mind and show me door for better career adn godo family life. Mother mary my saviour give me good joba or please saveme form all problems am goign thro inthsi compnay ,motehr amry there is always insecure feelign in my career adn fearin me adn i lack confidecne and not able to delivery things as per my CEO and boss 's request.My saviour help me over these problems and forgive my sins adn forgive my paretns if they haev huted soem one adn pls show me way for my surval.My saviour in your name am startign my day adn this week adn bless all my travell so that everythign goes well as per the plans withotu wastign any time. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatenign danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-07-18
BRYAN Dear Mother Mary, Interceed with your son our lord Jesus Christ & help me find a better job. mumbai 2014-07-18
maniyan paramasivam amma. i love you amma. i am sorry for all my bad behaviors i did so far amma. i want you to be with me and bless me forever amma. be with me and bless me forever amma. i submitted my wants to you through this website and asked you so far amma. i want you to give all of them. amma. be with me and bless me amma. if i get all of my wants i will be good and i stop doing all my bad habits amma i love you amma. i love you amma. be with me and bless me amma. with your blessings maniyan paramasivam. surat 2014-07-17
Jacob I am suffering from stomach related issues and continuous tiredness from past 6 months. I have consulted all possible doctors still remedy.It is not even diagnose properly>medicines are not even working out. Next month is my marriage...I am helpless and pray for your mercy matha. You are the only one who can help me out at this situation. Request your prayer to god the savior to help me out. I will promise that i will come to the church and pray at your foots....Please help me my ammma to get rid of this critical condition.. Pray for ammaaaaaaaaaaaaaaaaa dubai 2014-07-17
Peter Mother pleas pray for my financial problem. help me to lead a good christian life mumbai 2014-07-17
mary durai pls matha, Help me i need a baby. thank u matha singapore 2014-07-17
poosa durai Dear Matha, pls matha to bless me a baby. singapore 2014-07-17
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and all people that pray and seek Your Divine help. Amen. --- 2014-07-17
r kathu kollane mathave.koode undayirikkename mathave. i pray for my programming assignment and than sean says yes to our request for testing.please please please be with me amma in this hour of need.plesae take care of me. guard me from all evil.mathave i also pray for aaron and mumma.Father Lord, Lor Jesus, Holy Spirit, St Antony appacha, St Jude appacha, kaval malakhamare, kanyattunirappu muthappanmare , appe, archangel Gabriel malakhe kathu kollane.I pray that the work be completed on time today and the I get a yes from sean.mathave, please please please be with me and help me. sc 2014-07-17
anita c shukla Mother Mummy should not get another stroke again and plz she should not suffer from memory loss. plz Mother bless her with good health Rajkot 2014-07-17
M.S.D. I feel suicidal, please pray over my finances and my job, My wife and I have been victims of curses and witchcraft please pray for us please help Canada 2014-07-17
Shany Please pray for Shany to pass the rn exam today. usa 2014-07-17
Shany Please pray for Shany to pass the rn exam today. usa 2014-07-17
Shany Please pray for Shany to pass the rn exam today. usa 2014-07-17
r Mathave, thank you for making sean say yes. Thank you amma for your love and kindness. Amma i pray for my pa due tonight. Please help mohammed complete it on time and do a good job on it.Please make him communicate with me. amma i also pray for aaron and mumma that you may please help the in this difficult time.kathu kollane mathave. koode undayirikkename amme. sc 2014-07-17
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-17
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-17
S Dear beloved mother Mary, mother please help me , mother please save me from all the tensions and stress I am bearing now, mother as I am not feeling well , I am suffering from severe wheezing ,I am unable to breathe mother ,have no strength to do any work mother and have a small child to take care of, mother please help me , mother please heal me , mother have mercy and heal me, mother do miracle and heal me, heal me totally whatever bothering me, and bless me with good health peace and happiness forever, mother I need you , please come to me now mother , please come into my life now mother please hold me heal me change me and strengthen me Mother, mother as you know everything about me mother, due to my marriage issue my dad left me totally , since 7 years I am living far of my parents and home , mother please reunite bus with my parents and home now , mother please have mercy and hear my cry now , please mother reunite with my parents and home now and bless me and all my family with good health peace and happiness forever , mother I beg this and i pray this in your name mother amen. bangalore 2014-07-17
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVALOOKAVVAVERYTIREDAVVAANDAVVAGOTAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAANDAVVABLESSAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA…… Bangalore 2014-07-17
kavitha henry Mother Mary pls pls have mercy on my family amma,yesterday evening Vail coming from tuision she felt down in the road and she got hurt near to the eye.amma pls be with her amma And bless her amma why your giving so much of problem amma pls pls give her good memory and be with her amma I am requesting you how much pain she will be having amma soon that hurt have to go and her face should be normal amma pls bless her amma give her good habits amma this is last for my daughter apart from this nothing should happen amma this is my request from you amma she have to study nicely amma and come up in the life for any thing she should not put her head down amma pls be with her she have to study nicely amma, amma my son is having cold and fever from 2 days amma my husband is not caring for any thing amma only he is drinking always and every day he need to drink amma what should I do amma I having so much of problem amma money problem and all the golds in the shop the interest is going up aamma I'm not able to pay the interest also amma pls help me that I should get a good job soon without any certificate amma pls pray for me amma and help in my business amma and I should not put too much of weight amma pls help me amma I should be only 55 kg amma and my stomach should go inside and it should be flight amma pls bless me for this amma always bless my family amma and I should not get angry at all amma always I should be cool person pls bless me amma and love me amen. bangalore 2014-07-17
Maria Doss Roche Victor Thanks Madhavee, Thanks for b;lessing us, Thanks for guarding us all the time , Thanks for traveling with us all the time, Amen Chennai 2014-07-17
JHONSON ANTHONY MOTHER I NEED YOUR HELP AND GUIDANCE AS I GIVE MONEY TO HELP MALARKODI SUBRAMANIAM SHE NEVER PAY MY MONEY BACK WHERE BY I BORROW FROM PEOPLE PLEASE HELP TO GET APPROVAL OF MY LOAN TO SETTLE ALL MY DEBTS AND GIVE FINANCIAL HELP TO ME ON MY NEW TAXI. MY LIFE TO PROTECT BY YOU AND LED BY YOU MOTHER IN WORKING PLACE AS WELL IN MY TAXI DRIVING (HWE2456)REQUEST BLESSING FOR MY NEW FRIENDSHIP WITH SUMATHI SHANMUGAM HEAL HER FROM ALL SICKNESS AND BREAK ALL BONDAGE TO ALL HER FAMILY MEMBERS FATHER AND MOTHER GUIDE HER WITH YOUR GRACE AND BLESSING. I NEED YOUR BLESSING MOTHER BE WITH ME AT ALL TIME OF ALL MY GOOD THINGS DONE DAILY. PLEASE PROTECT AND BLESS DATO ALEXANDER CHACKO FOR ALL HIS PROJECTS FOR SUCCESS AMEN AMEN AMEN Kuala Lumpur Malaysia 2014-07-17
all of us Amma plz cure pariyamma she fell down plz ma my aunty should get wel soon accecpt our request amma love u amma Pune 2014-07-16
kavitha henry Mother Mary pls have mercy on me amma pls help that soon I have to take all my jewels from the shop amma pls help me amma and love me amma in the office nicely business should happen amma and we should get good business amma pls mother Mary amma bless me my interest is going up amma how I am going to take back my golds I do no amma she will not leave me amma pls help me amma and pls give me one nice job amma with good pay amma I should get a good job without any problem near only I should get the job amma my life is in your hand only amma pls bless me amen. bangalore 2014-07-16
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A VISIT TO VELANKANNI AFTER MY MARRIAGE,SHOWING MY MARRIAGE IS YOUR BLESSING. BLESS ME WITH A CHILD,NAME OF THE CHILD ON SILVER FLOWER. BLESS ME WITH A OWN HOUSE,MODEL OF THE HOUSE IN SILVER. BLESS ME WITH A CAR. BLESS ME TO COMPLETE THE COURSE(AERONAUTICAL ENGG.) SUCCESSFULLY. BLESS EVERYBODY WITH PEACE,HAPPINESS,JOY AND PROSPERITY. BLESS ME WITH MANY VISITS TO VELANKANNI. THANK YOU...................... Tiruchanoor,Tirupati rural. 2014-07-16
rosely ouseph Mother Mary please pray for our family members,our children to get good health and wealth,and get God's grace family life. kerala 2014-07-16
SIMA JAMES PARMAR I SIMA, FROM ANAND, GUJARAT. MY ELDER SISTER "REKHA" IS 39 YEARS OLD, UNMARRIED, PLEASE PRAY FOR HER MARRIAGE AND SUCCESS MARRIAGE LIFE. MY YOUNGER BROTHER-IN-LAW "MADHUKANT" IS 38 YEARS OLD, UNMARRIED, PLEASE PRAY FOR HER MARRIAGE AND SUCCESS MARRIAGE LIFE. ANAND 2014-07-16
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen -- 2014-07-16
daughter Thank you Mother for helping my sister to make the funds. Please help me to get the claim and my valuables . Pray for my children and my husband please mother ....thank you sdf 2014-07-16
BETHEL LEO JOHN Dear Mother, Mother I'am worried about my results, please help me my results will be declared on this week please help me mother. Give me good result. Mumbai 2014-07-16
BETHEL LEO JOHN Dear Mother, Mother I'am worried about my results, please help me my results will be declared on this week please help me mother. Give me good result. Mumbai 2014-07-16
r kathu kollane mathave.koode undayirikkename mathave. i pray that sean will say yes today to our request. i pray for my dmv exam and taproot.please kathu kollane mathave. Amma, i surrender my life in your hands. please be with me always and guard me from danger. Father lord, lord jesus,holy spirit, st jude appacha, st antony apache, kavalmalakhamare, kanyattunirappumuthappanmare,archangel gabriel, appe please be with me today and help me with these important things in my life. i pray for mummy's flat and aaron's good behavior.kathu kollane mat have.koode undayirikkename mat have. sc 2014-07-16
MS Mother of Velankani, look down with pity on my daughter and heal her from her present health condition. Despise not my petition but hear and answer my prayers and bless this child. A thousand thanks to you O Mother. CA 2014-07-16
kerina dear ma me kerina noronha praying to u to bless me with twines kids one boy an one girl I know ma u wil nevery let me down please ma u have given me every think I life bless me an my husband this comeing year. do pray for me ma. goa 2014-07-16
Ruwanthi Baby Sarani (1+ years)to be healed of all illnesses and be healthy and strong like a normal child of her age. Baby Hirun (5 years) to be healed of Wheezing and her eye to be healed. Sri Lanka 2014-07-16
SM Please pray that CShekar is fully healed and the reports show that there is no problem, also that crm returns all my dues immediately after a very easy and comfortable sale. Please pray that liandman are ashamed and change completely and that she could leave urgently, please pray that Alensa gets very good grades and that SS has no problems at work and that Lan is humbled and does not cause sorrow to the workers and smv's happiness and good health. M 2014-07-16
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-16
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAMARIAAVVAAVVAAVVA……. Bangalore 2014-07-16
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-16
Roche Victor Maria Doss Nandri Madhavee, Thanks for this wonderful life . Amen Chennai 2014-07-16
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house,good increment, good promotion. mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension, Mother please bless avi n me good health n job satisfaction. Mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. mumbai 2014-07-16
mm Ma Good Morning Ma and thanks Ma, Ma please touch my daughter and heal her u alone can do wonders and i am confident in you Ma. Ma Please take all my daughters papers to the right hands and excell her in all her papers. Mahelp us financially and bring a good tenants for us. bless all our near and dear once. Thanks Ma. auih 2014-07-16
Patsy Nunes Dearest Mama Mary, I place my following intentions at your feet, please bless me and my family. a. Good health to me and my family. b. Financial blessings. c. Our Portugues passports to be processed at the earliest. d. Siritual and temporial blessings e. My sincere thanks giving for the favours received by your grace. Thank you dearest Mama Mary and my loving brother Jesus. Mumbai 2014-07-16
daughter Mother please help my sister to arrange for the funds, please help them to be relieved of all burden ...... please mother pray for peace in our families. Bless my children and husband. Pray for my father and all my near and dear ones. Bless us mother and pray for us. Help me to get back my lost valuables. asdf 2014-07-15
vino Pray for my family Pease and pay for the family's those who have not having Pease, let go into Pease and joy. our lady of health Velankanni pay for us. LET ME PRAY FOR ALL ON THIS SUTIVATION AND LET ALL THE ISSUES SOLVED IMMEDITELY IN THE GRACE OF MOTHER MARY chennai 2014-07-15
VIJAYALAKSHMI BULLA My husband looking for a change in his job, so pray for my husband to get a new job, also to increase our financial status. Pray for my son (V S Tanav Kosuri) in his studies and give good health & wealth. Mary Matha please help in our health problems, financial problems and give us the strength to face them successfully. Please bless my husband, my son, parents, sister family and brother family too. Pray for me and bless me amma. Mary matha please pray for me to continue in this job with out any problems. Please help us and give the strength to face each and every problem whatever we will get. Mary matha please help us from the court case which is facing by my father, mother, siter and brother-in-law, please help in us to close the court cases as early as possible with out any problem & financial expenses. You know that the case is false case, so please help our family members to over come and come out of that problem (court). Mary matha please give the peaceful life to us and take away all the problems from us. Please pray for me (Mr. & Mrs. Srikanth Kosuri) and my family too. Thanks for your prayers. Hyderabad 2014-07-15
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones Amen. ---- 2014-07-15
Sheeba Amma Please help me.Now my husband is started to fight with me and my son.Tomorrow we will go to India.Please come with us.He is telling "he is not sent my daughter with me to my parents house".he is scolding my son.Please Amma. Kuwait 2014-07-15
narayanasamy save my daughter jn umadevi from her family problems and help her to lead a normal life chennai 2014-07-15
jikku maathaave... enikku nalla chinthakal nalki anugrahikkanamae.. ammae mathavae.. enikku koottaayirikkanamae... entae manassil othiri sankadangal ondu.... njan othiri prayasangal neridunnumundu.. ammae enikku ellaam neridaan ulla shakthi tharanamae... ammae maathave.. kerala 2014-07-15
2014-07-15
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma here I submit prayer tomorrow court case ma help us to win this case ma we should get compensation ma.Thank you ma. Auh 2014-07-15
2014-07-15
clarence moreira Our Loving Blessed Mother please take care of all our family needs. Help us spiritually, physically & financially.Help my son' SYLVESTER'in what he has decided take care of all the Court order etc;Please be beside us , grant us wisdom & peace.Amen. Chennai 2014-07-15
clarence moreira Our Loving Blessed Mother please take care of all our family needs. Help us spiritually, physically & financially.Help my son' SYLVESTER'in what he has decided take care of all the Court order etc;Please be beside us , grant us wisdom & peace.Amen. Chennai 2014-07-15
clarence moreira Our Loving Blessed Mother please take care of all our family needs. Help us spiritually, physically & financially.Help my son' SYLVESTER'in what he has decided take care of all the Court order etc;Please be beside us , grant us wisdom & peace.Amen. Chennai 2014-07-15
r kathu kollane mathave.koode undayirikkename mathave.thank you for your love and kindness amma.thank you so much for being with me and helping me through all my difficulties. amma, I pray for my 154 and 143. i pray for my dmv exam tomorrow. i also pray that sean says yes to our proposal.kathu kollane mat have. i pray for aaron and mumma that you make him well behaved and that you may please heed to her prayers.thank you mathave.praise you mathave. sc 2014-07-15
SM Please pray that God touches Li and her husband that they cannot cause any trouble in my life, that they become loving and do not meddle in our lives and that she leaves this week and does not return for a few years, that Lannel is humbled and that she stops harassing SS and that SS gets a good new job also that Rephesa becomes loving and responsible and completely changes and is a blessing to her family. Please pray that all of them cannot affect or pain us ever and Smv loves me and the marriage takes place as planned.Urgently pray that CRM returns all my dues this month and a peaceful sale takes place and that he dos'nt give me any sorrow. Also that Alensa gets very good grades and Zoey is healthy. M 2014-07-15
Deepa Amma, Thank you for all the blessings that you have poured on my family. Amma, today I'm really worried about my little son Johanns health. Amma please help him . Please heal his stomach pain and nausea. Amma he has gone to school after a break, and his medicine is taken to school. Please help him amma, give him strength and courage. Please heal my son completely of his illness .Amma, let him be happy like other kids in his school. Thank you Amma for listening to my prayers. Amen. NSW 2014-07-15
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-15
JS our loving mother, Mother of our God. I ask for your prayers for my children. They needs God's mercy. Please ask for His forgiveness and blessing on my family. Heal us and bless us and be with us always We need your love and protection every day in our life. Heal my daughters sickness and release her from her struggle in her life and bless her with good health, love and prosperity. I am certain that My God your son will bless my family and guide us . australia 2014-07-15
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA…… Bangalore 2014-07-15
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-15
Sheeba Amma, I am very sad because of my husband and his parents and sister.Today we are are going to India.I feel very afraid.Please Amma come with me.My children talk any thing that time the fighting will start.I and my children should not talk any unwanted things.Please Amma guide us.I couldn't concentrate any activities and my duties.They should not ask my jewels and my properties.and I and my children are not interestet to meet his sister and are not interested to go to her house.Please Amma help me and guide me.Please give peaceful mind and relax.My small daughter is telling about his parents.That time fighting stared.Please Amma, yennaleyo, my childrenlayo oru pracchanaum varakkoodadhu.Santhosama poyttu santhosama kuvaithukku next month varanum.Payama erukku.eppo sanda vanthirumo enttu.Amma please amma,come with us. porumai,samathanam ,santhosam ,anpu amaithi tharum anpu esuve.snda vendand payama erukku amma....pilla yaraiyumpatti onnum chollakkoodathu. Ammma please...After reaching India his parents pesanum.sanda podakoodaathu.Please amma...pillayangala patthirama parthukkanum. Kuwait 2014-07-15
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-07-15
lavi Mother Mary Bless me and my family.Pray for me.Amen uae 2014-07-15
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. mother please bless avi n me good health n jobs satisfaction. Mother please bless us get agood full time maid> mother please bless my family peace n happiness mumbai 2014-07-15
Tarika Selvam Velankanni Amma, as u know our current situation please help us to come out of this problem by today itself. Please pray for my family and help my dad to get back his money. Bangalore 2014-07-15
Maria Doss Roche Victor Nandri Madhavee, Thanks for this wonderful life , Nandri Madhavee... Amen Chennai 2014-07-15
mm Ma Good Morningand thanks Ma. Ma please heal my daughter cyst and take and correct all her papers and excell her ma and bring good tenants and help us to clear the tenancy contract. auh 2014-07-15
mm Ma Good Morningand thanks Ma. Ma please heal my daughter cyst and take and correct all her papers and excell her ma and bring good tenants and help us to clear the tenancy contract. auh 2014-07-15
mary stanly to dear mother mary thank u for whatever u have given me till today thanks for the good health of my husband ravi. oh mother please help my son in getting a good job this year i will come to velankani bless him with all his desires. iam very much worried plz help me and my son rohit. bangalore 2014-07-15
christy dear ma, no change for our situation. dear ma help us to over come this. we are in a maze i think. things seems to come positively suddenly all of them change within seconds. we feel no way to overcome. dear ma what should us do? dear ma help us to find out new works. dear ma help us to find out a client who is ready for the new house in velmam. help us to find a family or party for rent. dear ma we beg you. pray for us to your dear son. ngl 2014-07-15
MANIYAN PARAMASIVAM amma. i submitted my wants to you so far through this website and asked you amma. i hope i got all of them. i love you amma. i want you to be with me and bless me forever amma. i love you amma. make me so brilliant and intelligent, never give up my confidence, amma. i should be so successful and right,, amma i love you. all my wants i submitted you in this website i hope i got all of them amma. be with me and bless me amma. i just believe in you amma. i love you amma. i am going to be good with the believe that you had given me all of my wants amma. with your blessings maniyan paramasivam surat 2014-07-15
siby Ammma mathave please help your child to tide over current panic situations due to unexplainable causes leading to misunderstanding between me and wife and neagtive interference of wife parents. Due to peculaiar behaviour of wife she feels insecure and distrusting me due to her controlling parents and neagtive emotions .Now we are on verge of parting. But dear amma we know Our lord and amma wont Like all Kind of divorce in case like ours where there is no kinding of torturing or sexual abuse/cheating.Please pray for us to understand each other trust each other Love to deep heartas per lords wish.We were having a good life till one month but due to involvement of her parents and negative attitude of my wife we are reaching to a point that there is no love from my wife or she hides to suppourt her parents instead of her husband.Amma please give a warning signal to all who try to break down our relationships as we still love at heart though wife is not showing.Its very hard amma living like this.iam forced to spoil our good days in married life due to unexplained reasons that made my wife laking trust in me .Amma as you know my situation pray to Lord to have his wish done in our Life chngannur 2014-07-14
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing us all the time , Amen Chennai 2014-07-14
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER MARY,I WANT YOUR STATUE FROM SANTHOME FOR EDUCATION AND AFTER MARRIAGE WHEN I COME TO VELANKANNI,I WANT YOUR BIG STATUE THAN WHAT YOU GAVE ME FIRST TIME. MOTHER MARY,JESUS SHOW'S LOT OF VISIONS TO MANY PEOPLE AND PAINTERS WILL KNOW HOW TO REPRESENT THEM PROPERLY AND AS FOR AS I KNOW,MANY LIKE JESUS PAINTINGS IN THE WORLD.I LIKE JESUS STRECHED HANDS STATUE VERY MUCH.I LIKE TO KEEP IN MY HOUSE AFTER MARRIAGE ONE BIG JESUS STATUE(STRECHED HANDS),MOTHER VAILANKANNI,VINAYAKA(I WANT TO CARRY WHAT YOU ARE GIVING ME FOR MY EDUCATION THROUGHOUT MY LIFE AND WILL KEEP THEM SAFELY) AND ANJANEYA SWAMY AND SAI BABA.I WANT TO VISIT EVEN SHIRDI AFTER MY MARRIAGE,WITH MY CHILDREN,AFTER BUYING A HOUSE............................. PLEASE THINK ABOUT IIAST,INDIAN INSTITUTE OF ASTROPHYSICS. AFTER DOING AERONAUTICAL ENGG. IN M.TECH,I WILL GO FOR A JOB FOR ONLY ONE YEAR.THEN I WANT TO DO M.TECH+Ph.D IN ASTROPHYSICS,MY DREAM:))) PLEASE BLESS JOBBIN ABRAHAM BEN,GOOD HUMAN BEING. BLESS HOME WITH PEACE,HAPPINESS,JOY AND PROSPERITY. THANK YOU.................................................. THANK YOU. Tiruchanoor,Tirupati rural. 2014-07-14
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-07-14
Gurcharan Singh S/O Azimar Singh Hail Mary Full Of Grace, Our Lady Of Good Health Vellankani Matha I let go all my problems, worries, anxious and anxiety to you to handle by the grace of Holy Son Lord Jesus Christ. Mother please bless me and my family. Guide me, be with me to focus and concerntrate in my work Help me to get rid of all evil thoughts and things Amen Petaling Jaya, Selangor 2014-07-14
Maria Doss Roche Victor Thanks Mother , Thanks for being with Mrs Chitra and blessing her pregnancy , Nandri Madhavee, Amen Chennai 2014-07-14
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.give me job amma.thankyou amma. varahapatnam 2014-07-14
S Thomas O Mother Mary...Bless us ..i am really very upset for my sister is not getting any job...she is really disappointed , losing her patience and confidence,.... Mother Mary, you have the power to heal your children , wipe out the tears..please hear our prayer...answer to our prayer... my little sister needs your blessing....please...i cry out loud...bless her bless us...i know nothing is impossible for you , you will fulfill our wishes, our prayer...mathave... i cant see her upset...she is my love my life.. my everything...my sister..do some miracle...bless her...i have faith in you... am very sure and confident that you will listen to me my little sister and my mummy...our prayer... please...please give her good job...please please....bless us mother... Gujarat 2014-07-14
Ms. Amma, Pl save me and give me all good things in life and take away my sorrows. Pl give a happy life to LIVE amma.Pl fulfill all my dreams and help me in my wishes coming true Coimbatore 2014-07-14
r kathu kollane mathave.koode undayirikkename mathave. i surrender taproot, 154, 143 and my dmv exam in your hands today amma.please be with me and help me with everything that I do. Mathave, please bless me with your grace and kindness. sc 2014-07-14
JINU PHILIP ENTEE AMMEE AMMEE ENNICKKU VANNUU NERIL KANNUVANNUMM AMMAYUDE NOYAMBU NOLKKUUVANNUMM ENICKKU ANUVATHAVUM AVASARAVUM THARAN PUTHRANODU APPESHICKKANNAMMEE AMMEE AMMEEE U A E 2014-07-14
mahesh Dear amma please bles my family.give good health to vijaya kanna rishika amma and nanna.give me job amma.thankyou amma. varahapatnam 2014-07-14
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-14
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing our entire family , Thanks for blessing my spine , Thanks madhavee. Amen Chennai 2014-07-14
mm Good Morning Ma, Please take care of my daughters exam papers and you take it to the right hands and excell her in all her papers and wipe away her cyst. and our renewal finance. Thanks Ma auih 2014-07-14
jennifer Dear Mother, Thank you mother very much for this day and for all THE FAVOURS GRANTED. mOTHER PLEASE BLESS US BLISSFUL HAPPY HEALTHY MARRIED LIFE. MOTHER PLEASE BLESS MY SON GOOD HEALTH, MAKE HIM PEACEFUL AND NORMAL CHILD. MOTHER PLEASE BLESS AVI N ME GOOD HEALTH, MAKE US PEACEFUL, FREE US OF ALL WORRIES, HELP US IN OUR JOB, HELP US GET A GOOD HOUSE, GOOD INCREMENT, GOOD PROMOTION. MOTHER PLEASE BLESS US SORT OUR FAMILY DISPUTE. MOTHER PLEASE BLESS MY DAD OF ETERNAL PEACE. MOTHER PLEASE BLESS AVI N ME OF GOOD HEALTH N JOB SATISFACITON. MOTHER PLEASE FREE AVI N ME OF ALL WORRIES N TENSION. MOTHER PLEASE BLESS MY FAMILY PEACE N HAPPINESS. MOTHER PLEASE BLESS US GET A GOOD FULL TIME MAID. mumbai 2014-07-14
Michael Austine Anscur Praise the Lord,I praise to Mother Vailankanni. I am from Tirunelveli Dist,Tamilnadu.Tuticorin Diocese. I am at Dubai working in a company as Accountant. Now pray for me to get 20 days(in August)next month leave sanction for me from my company to come to my home town.It is mainly for some medical checkup for me.Iam a heart patient. Kindly pray for me. Once the leave approves I come to Vailankanni Church with my family. Thanks, I very much belive in Mother of Goodhealth. Dubai 2014-07-14
carol Dear mother ,I ask of you in faith to please bless my son help him to get good scores in collage help him to get a job as a bakery chef manager in the harbour marriott .help him with good health. thank you dear mother for all the favours that we receive. mumbai 2014-07-14
JOSEPH PATRICK WILTSHIRE MOTHER OF VELANKANNI PLEASE GIVE ME A GOOD LIFE PATNER , WHO WILL BE LOVING AND KIND TO ME AND SHE SHOULD BE A GOD FEARING PEARSON TOO . HELP ME OUT IN ALL MY FINICIAL WISE ALSO KEEP ME IN GOOD HEALTH TOO . PLEASE MAKE SUJATHA TO CALL AND SPEAK TO ME .... AMEN CHENNAI 2014-07-13
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen -- 2014-07-13
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME TO COMPLETE THE COURSE SUCCESSFULLY. BLESS ME WITH A CHILD,PROMISE TO GIVE THE NAME OF THE CHILD IN SILVER FLOWER. BLESS ME WITH A HOUSE,PROMISE TO GIVE THE MODEL OF THE HOUSE IN SILVER. BLESS ME WITH A CAR. BLESS ME WITH MANY VISITS TO VELANKANNI. THANK YOU. Tiruchanoor,Tirupati rural. 2014-07-13
Stephanie Angelina Aloysius Dear Mother Velankanni, Pls bless me & my husband with a baby & also a successful reply for my job interview in Shell (Oil & Gas). Pls keep my husband in good health & also in wealth. Bless him with good opportunities in his career. Malaysia 2014-07-13
sony amma heal rechal vydurya suffering severe pain in chest lungs & cough plz amma heal her bless her kurnool 2014-07-13
Deenadayalan Dear Mother Mary, I am in a confused state but happy that I have your blessing in moment like this. Dear Mother, please have Kirthika call me, I cant live without her. I have made my mind that I cant have a life without her and please Mother, I cant take the disappointment twice. I want to wipe my sins with my tears at your feet. Bless me mother. Chennai 2014-07-13
Poppy Dear Beloved Mother, Tomorrow is my son's Maths examination. Please be with my son and help him to score more than 80% marks in tomorrow's exam. Yours lovingly Poppy Pune 2014-07-13
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health make us peaceful,free us of allworries, help us in our job, help us get agood house, good increment, good promotion/ Mother please bless us sort our family dispute. mother please bless my dad of eternal peace. mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-07-13
stephen C Dear People Of God, Please pray to Jesus and Mother Mary to bless all my wok for this week with no interference from any other depts. Pls also pray to stop the truck strike. Thank you Jesus praise you Jeusu love you Jesus- Servant of Jeusus-Stephen Mumbai 2014-07-13
Mary Dear matha, Pls help me my brother job. singapore 2014-07-13
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone , Anandri Madhavee. Amen Chennai 2014-07-13
r kathu kollane amme.koode undayirikkename amme.apathonnum varuthathe nokkename amme.amma i pray for aaron and mumma. i pray for taproot, 154 and 143. kathu kollane.koode undayirikkename amme. sc 2014-07-13
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-13
2014-07-13
mm Hello Ma Good Morning and Thanks to you and to your beloved son and blessed Joseph for all blessings and graces you have showered and protected. Ma, Now i humbly and urgently ask you to do some wonders for two things one for my daughter' s exam papers please take her papers to the right hands and excell her in all her papers and be the topper in her college. Wipe away her cyst as u r the best doctor and please help us financially to clear our house rent and bring good tenants for us. Thanks Ma auh 2014-07-13
christy amme madhave, today a party came to see the vell house. thay asked the document it seems. help us to confirm this party fo this house dear ma. we have no other way to move farward. we need to sell this as early as possible. two call also received from valliyur yesterday. help us to find a customer from this people. dear ma help us now help us now. dear ma, today we are going to prepare the drawing for the 6 storey complex help us to fix the work. also help us to start works in the avani so that we can find financial solutions and boring. thankyou ngl 2014-07-13
Alwyn Sweebert Tauro My friend Divya's mom has been hospitalized for Dengue fever and her platelets counts have reduced. Please pray for her speedy recovery. Mary Mother bless us Bangalore 2014-07-13
daughter Mother, keep us under your love and care, help my sister to overcome all her problems, help them to collect the money and deposit it. Please mother, help me to get back my gold , help the children and save me from all disgraces.........Pray for us mother........ dfd 2014-07-13
Alphy Amme ente room nu nale enkilum oru vadakakarane kittane,amme ente milankuttanum alankuttanum nannayi padikane,milankuttante asugam marane,eniku nannayi job cheyan sadikane,amme ente kadam ellam vegam veetan sadikane amme ninaku orayairam nanni,amme ente pray nee kelkane,enne sahayikane, amme njan konduvannu vachirikunna ente ella shirt pcs um chilavakane amme amen mumbai 2014-07-12
maria g d'sa mother mary jesus and joseph please help me to heal my boils which is come on the thigh with the pain and itching and i went to the doctor to examine. he gave medicines please mother with that medicine i should be get alright and boils,itching and pain should disappear. i always should be with your love mapusa goa 2014-07-12
mukiri siva prasad Mother bless for work about trust matters emmanuel Kishore & KJ foundation pray for this files to be done , mother my wife health is not good, give her strength power . GUNTUR 2014-07-12
kavitha henry Mother Mary pls have mercy on me amma pls help I should get one good job soon amma pls help me and I should have good salary amma I should get a job in good company with good salary and without certificate I should get good job amma amen. bangalore 2014-07-12
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Hope. Please do not forsake my loved one and me. Amen. --- 2014-07-12
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless them in bangalore.give me job amma.thankyou amma. varahapatnam 2014-07-12
SAJIN pls save her and give peace and happiness balaramapuram 2014-07-12
r kathu kollane mathave.koode undayirikkename mathave. i pray for my 143 and 154.mathave i pray that I get good marks in both.I pray for my upcoming exams and for me to get a job.kathu kollane mat have.koode undayirikkename mathave. Father lord, lord jesus, holy spirit, st antony apache, st jude apache, kaval malakhamare. kanyattunirappu muthappanmare, appae kathu kollane.I especially for the marks of my writing assignment 1.I also pray for mummy and aaron. sc 2014-07-12
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma today I said my 1st week novena.Ma first I thanks you blessed us the problem I had with my wife,ma thank you ma for giving her to understand the truth.Thank you ma. Auh 2014-07-12
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma today I said my 1st week novena during the novena hear my petition ma.Ma we are planing to buy land, it is your blessing ma if that land is for us mean we should buy without any problem we should get loan,help us ma for our needs.Ma today mu mother birthday thanks you ma past all these year you gave her good health, further give her good health to celebrate her bithday every year.Ma my dad leg been wound bless him ma to heal the wound soon.Ma my second daughter gone for project with is team,protect them ma from all danger and sick,team work they should do well their project and return home safely ma.Thank you ma. Auh 2014-07-12
mary O mother thousands and millions of thanks o ma for helping me in the phase of my life, oh maa i beg of you to help me to do well in my work bless me to get promoted to a higher role. Bless me with a house o maa for which i have been longing for. bless my children in their education. i ask you in the name of jesus your loving son. Amen hyderabad 2014-07-12
SM please pray for me that the filing can be done easily without any problem, no rain and all three of us are happy, touch Li that she is quiet and my mother that she is healthy and eating well and for Mini;s good health. Please pray that the trip is a huge success and my efforts are appreciated that Anu is quiet and happy and for Susan's peace of mind and good health that crm returnsall dues immediately and the sale is easy and Zoey's good health and for Alensa to get good grades. m 2014-07-12
kavitha henry Mother Mary pls have mercy on me amma bless my family love my family you have given very sweet son and daughter I love both of them so much amma, today is my son batsim amma the name is. Kevin henry pls bless is name and give him good memory power and love and he should come up in the life very big person he should never go any wrong way amma always need your blessing with my children's amma pls bless my both daughter and son special blessing for my son today amma....pls amma soon I should get one good salary with out any certificate and half in Saturdays amma pls bless me amma and soon I have to take back all the golds from the shop amma pls bless me in this amma and nicely it should happen my business amma pls bless amma give us more admission ..... And keep me slim amma and my stomach is to big make small amma I don't want to put any weight amma pls you know that I have put too much of weight last time only and I have health problem amma pls have mercy on me and love me amma pls bless our family amma amen. bangalore 2014-07-12
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-12
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.give me job amma.thankyou amma. varahapatnam 2014-07-12
mm Ma good morning and thanks ma for bring my daughter safe and sound and please give us the financial support for next month renwal. Ma please take all her papers to the right hands and excell all her papers. Ma remove totally her cyst ma. Thanks Ma auh 2014-07-12
stephen c Dear People of God, I thank Jesus, Mother Mary very much and you people of God for all the the blessings, petitions and Grace received during this week. Thank you Jesus praise you Jesus love you Jesus- Servant of Jesus-stephen Mumbai 2014-07-11
lavita mama mary i thank n praise u for all ur choicest blessings on me n my fly.mama i come before u today with lots of intension.mama i first of all surrender u my mom,her work,good health of mind,body n soul.bless her protect her n b vid her alwys.help her in all the decision dat she makes. save her from her madam angry.fulfil all her vishes...mama 2ndly i surrender u my sis,vho is very soon going to begin her profesional study.mama u be vid her.bless her studies,give her goood health of mind body n soul...guide her to the right path..be vid her alwys..lastly i surrender u myself,my studies,model exam ,final exam.give me mother the grace to study hard n do well in both the exams n pass vid flying colours.protect me n my family alwys.i ask u to give me good memory to remember whatever i hav studied n perform excelent in my all exams...give me goood health of mind ,body n soul...n guide me alwys to the ri8 path...i suurender all my intention at ur feet...let it b done according to u wiill...i make this pray to u amen.... manglore 2014-07-11
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-11
mahesh Dear amma please bless my family.give good health to vijaya amma kanna rishika and nanna.give me job amma.thankyou amma. varahapatnam 2014-07-11
subramanian Dear Holy Mother Mary Please forgive my sins and bless me and my mother. My mother has lost both eyes vision due to glaucoma and weakness in central nervous system. She is undergoing Ayurveda treatment. Please bless my mother to restore her vision in both eyes. Thanks. Please bless me to clear all my debts. Vailankanni Matha I have given the letter for VRS kindly sanction it and make the settlement as per VRS immediately. You know mother about my financial position, so please help. Thanks Regards Subramanian Kanchipuram 2014-07-11
r kathu kollane mathave.koode undayirikkename mathave.please please please be with me mathave and help me with everything that I do.thank you for your grace, kindness and love.thank you for your blessings and for watching over me amma.You are my refuge and my strength , the one who listens to my prayers and helps me and my loved ones in our times of need. mother you are my strength and fortress. I pray for 154 and 143.please help me get good marks in both. please help me with taproot interviews next week. I pray for aaron and mumma that you may keep them happy and safe. i pray for a job amma.father lord, lord jesus, holy spirit, kanyattunirappu muthappanmare, st antony appacha, st jude appacha, kaval malakhamare, apps kathu kollane..koode undayirikkename. sc 2014-07-11
kavitha henry Mother Mary pls have mercy on me amma and pls bless my office to have more admission amma and I should get one good job soon amma we by means I have very big money problem amma pls have mercy on me amma that I should get the job like vasantha amma pls bless me amma pls pray for me that my office also should improve and monthly I should have more than 10 amma pls amma love me and bless me amma and bless my family pls amma love me amma always bless my daughter and son amma and me and husband also amma pls amma amen. bangalore 2014-07-11
Baby Velankanni Mathave , My heart is full of Thanks to Mother Mary for helping us all throughout.Mother Mary has interceded for us in our prayers. Mother was with us every moment helping and guiding us, showing the right path, right person at the right time.Kindly bless us with peace and happiness . Please be with us and guide my son in future also.Mathave,Please look after my son at every step. Kndly take care of him .I will light candles at nearby Velankanni church every month. I will visit Velankanni Church. Amen. Kottayam 2014-07-11
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensions and stress I am bearing now, mother please help me, mother as I am not feeling well , I am suffering from severe wheezing , mother I am unable to breathe, mother became very weak, have no strength to do any work , and I have a small child to take of,mother please heal me, mother touch me and heal me now, mother please heal me, mother have mercy and heal me,mother do miracle and heal me, heal me totally whatever bothering me mother,and bless me with good heslth peace and happinezs forever,mother please come to me now I need you mother please cone into my life now and hold me heal me change me and strengthen me, mother please help me mother, mother as I know everything about me, due to my marriage issue my dad totally left me and restricted my mom a day all my family not to keep any contacts with me , since 7 years I am living far of my parents and home mother, mother please soften my dad heart now and please let my dad forgive me and accept me my husband and my child now mother, mother please hear my cry and answer all my prayers mother, mother please help me , please grant my prayers now mother , I beg you mother please respond to my prayers now mother, mother reunite us with my parents and Home now and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-07-11
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensions and stress I am bearing now, mother please help me, mother as I am not feeling well , I am suffering from severe wheezing , mother I am unable to breathe, mother became very weak, have no strength to do any work , and I have a small child to take of,mother please heal me, mother touch me and heal me now, mother please heal me, mother have mercy and heal me,mother do miracle and heal me, heal me totally whatever bothering me mother,and bless me with good heslth peace and happinezs forever,mother please come to me now I need you mother please cone into my life now and hold me heal me change me and strengthen me, mother please help me mother, mother as I know everything about me, due to my marriage issue my dad totally left me and restricted my mom a day all my family not to keep any contacts with me , since 7 years I am living far of my parents and home mother, mother please soften my dad heart now and please let my dad forgive me and accept me my husband and my child now mother, mother please hear my cry and answer all my prayers mother, mother please help me , please grant my prayers now mother , I beg you mother please respond to my prayers now mother, mother reunite us with my parents and Home now and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-07-11
candiss Dear god,i thank you for all the blessings showered upon shayne and myself. I thank you for the gift of our beautiful parents who have been by our side at all times. Today i once again come before you to heal shayne of all his sickness' and to take away his pain. I beg of you for his good health and prosperity in all that he does. Thank you lord. kuwait 2014-07-11
G V AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-11
mary magdalene o most gracious mother,thank u for showering ur abandant blessings on me and my family.thank u for guiding me till this second in ur path.dear mother mary,give me the knowledge and memory power to study well and do my higher secondary board exams well.this i ask in ur holy name.Amen neyveli 2014-07-11
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A BABY BOY,I WILL GIFT YOU NAME IN SILVER FLOWER. BLESS ME WITH A OWN HOUSE,I WILL GIFT YOU MODEL OF HOUSE IN SILVER. BLESS ME WITH A CAR. BLESS ME WITH MANY VISITS TO VELANKANNI. THANK YOU VERY MUCH FOR EVERYTHING IN MY LIFE. Tiruchanoor,Tirupati rural. 2014-07-11
Cecilia Dear Mother your son Yves is in trouble, please help him, bring peace to he heart. Let all the bank problems be resolved. Thank you Mother. Thank you Jesus. Thank you St. Joseph. Abu Dhabi 2014-07-11
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job,help us in our increment, in our promotion. mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. mother please bless my family peace n happiness mumbai 2014-07-11
henry mother mary please bless me with good health . my office should get good admissions , this month it started very well and it should grow very fast . the unauthorised office should be closed.we should get admissions daily. bless my family with all happiness. thanks mother mary. tomorrow my son baptism should happen happily. my childrens should have your blessings abundantly . ave maria. amen. bangalore 2014-07-11
Prasanna Kanojia Mother thank you for giving me everything. I pray to you to bless me and my entire family with good health. Bless my mummy and daddy with good health and happy life. I pray to you to bless me with the strength to full my commitments that i have for nmy dear ones. Bless my baby with good health and help and guide me upbring her as a good humanbeing Mumbai 2014-07-10
2014-07-10
CG Mother Mary be with us always .keep my family in good health of body and soul.mother Mary I have a lump on my head. Please intercede for me that the lump might go away. Thank you for all the graces u have showed on us.be with us always Na 2014-07-10
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. -- 2014-07-10
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.thankyou amma for blessing the journey.give me job amma.thankyou amma. varahapatnam 2014-07-10
mary durai Dear matha, thank u so much.I love matha.thank u matha my health problem little bit solve today i m so happy thank u matha singapore 2014-07-10
kavitha henry Mother Mary amma pls have mercy on me amma pls bless me soon I have to take all my golds amma pls have mercy on me amma pls arrange me some one should give me the money to take all my golds soon from the shop amma my interest is monthly 12000 I have to pay amma but I am paying only 3000 aamma pls bless me and love me amma in my life so much of problems amma pls because of me open your eye and listen to my prayer amma pls pls I beg u amma pls some baddy should help me amma u arrange some one should give me the money amma pls pls don't leave me in big problem amma as u no every thing all the golds are not mean its ally auntes also that only I am so scade amma if its my gold there is any problem and need not to worry about any thing amma its also aunty golds also its there amma pls arrange me to pick up the golds amma pls bless me and need your help for me very urgent amma and Joseph is telling to buy one more car you only tell me were will I go for money amma when will I by my second car for the driving school and pls improve my business amma it should happen more and more admission amma soon I should solve all my problems amma pls pls amma ....amma bless me that I should not put more Waite amma pls love me bless me amma my stomach is very big and very bad amma pls pls me in my health amma already I am having health problem amma pls keep me slim and decent look amma pls I beg for this amma I should not put more weight amma amen. bangalore 2014-07-10
r kathu kollane mathave.koode undayirikkename mathave. i pray for 143 and 154 that i may get good marks in both subjects. i pray for aaron and mumma that you be with them and keep them both happy and safe.father lord, lord jesus, holy spirit, st antony apacha, st jude apacha, appe, kaval malakhamare, kanyattunirappu muthappanmare kathu kollane koode undayirikkename.please please please be with us and help us with everything that we do. sc 2014-07-10
SM Please pray for Susan's protection, good health and peace at work and for lanel to become humble and co-operative, that Li is loving and quiet and also Helen and Anu, please pray that the trip is very good and filing is done easily and CRM returns all my dues immediately and for easy sale also that SMVgets good offers and is happy and for Zoey's healing. M 2014-07-10
Lona Mother Mary, Please help me to get through the interview and get a job. Thank you for all the blessings showered on me and my family. CENTENNIAL 2014-07-10
2014-07-10
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVA…… Bangalore 2014-07-10
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-10
jennifer Dear Mother, Thank you Mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries help us in our job, help us get agood house,good increment,good promotion. Mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please bless us geta good full time maid]. Mother please bless avi n me of good health n job satisfaction. Mother please free avi n me of all worries n tension. mother please bless my family peace n happiness mumbai 2014-07-10
Maria Doss Roche Victor Thanks Mother Mary , Thanks for blessing and guarding us all the time , Nandr Madhavee, Amen Chennai 2014-07-10
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH CHILDREN,THEIR NAMES ON SILVER FLOWER. BLESS ME WITH A OWN HOUSE,MODEL OF HOUSE IN SILVER. BLESS ME WITH A CAR. BLESS ME WITH A VISIT TO VELANKANNI. BLESS JOBBIN,GOOD PERSON. Tiruchanoor,Tirupati rural. 2014-07-10
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,peace of mind and protect us from all evils,dangers and accidents and forgive our and pls forgive me mysins and please save my job and protect my name and dignity in this company and save me am really very disturbed and sacared about my future ,mother mary this job is given by you for me ,its becaus eof your blessign and grace only i haev reached this position ,my saviour please dont let me down i fall atur feet,my job is instake becaus eof the Ipad adn covers ,i dont whether my CEO will keep me or throw me out ,my saviour coem to my aid and give me peace of mind save me adn my jewels ,i needs 3lac 50k to take out only my wife's jewels,and anotehr 3 lac to take out my mothers and my jewels ,i dont how to arrange this and from where to arrange this,please show mw ay for that i fall at ur feet i need this job because this oly i can lead a decnt life ,there is no opening any where i have been applying for job everywhere but no response ,pls my mother mary shwo em way adn saveme fromt his probelms,i dont know whether my boss is really not happy with me or people are making these stories ,my saviour in your anem only i start my day adn today am going to dehradun for the ext 15days ,i have lots of pending work which needs your blessign adn guidencae to complete ,am not able to compelte the work which is given to me and becaus eof this my boss adn my ceo have lost trust in me and my team.my saviour coem to my aid save me and my family pls give me confidecne and strenght to withstand this adn work hard adn prove myself.when will i come up in life everyday am living in fear of losing the job everyoen are happy adn secured inthere companies but for me everyday is problems ,tension and i haev no peace of mind adn not able to give the out put what my compnay wants .My saviour come to me adn be with guide me in all my meetings and save me from the clutes of fear and shwo me way for my career adn grwoth my family will be on roads ,am staying the rented house my committments are more and give me strenght and confidecne to withsatnd thee pressure adn work hard adn prove those pople whoare puttign me down.my promotion and increment are put down,i dotn knoww hat is the status of this where will i go and ask who will i ask for me expect you i donthaev anyone onthis earth my family ,were all dependent on your adn yoru blessing ,as committed i'll shave my head when i get new job and am saved formthsi IPAD problems and my CEO has developed such bad immpression aboty me i dont how to coem outthis what is way ,for me its the death is the only way,my saviour pls coem to me show me adn bless me with sucess adn prosperity and show me wa forward. My saviour dont let me down one itnerview i attended but that's also on hold pls my saviour what do i do how much can ipray adn how much of humilation i can go thro and what esle can i do,other than mylife i haev nothign with me pls coem to me bless me adn give me strenght adn guide me in all my meetings adn bless my IT infra to be sucessful ,my job my jewels adn my family is my top priroity ican do anythig to ge tin place pls be with me guide me and forgive me for being rude arragant and save my job my saviour in your anema m starting all my work so pls show mercy on me and my team my job adnon my family who is totall y dependend ton me and motehr mary i haev only 20 days to tek out my jewels otherwise i'll lose it if i dont take it now,pls motehr mary as committed i'll put one gold chain in our shrine if ge tback the max of my jewels ,am not egbilbe for loans also and my cbil ratign is still in the dilmean. In your naem am leaving this office and goign to dehradun pls safe gaurd my family,my house adn protec them and hosue form allevils,danegrs adn accidents adn save my job adn name in this company ,i odnt need apperication i just ned your blessing and grace adn protection form all my problems. AM not ablet to come to to your shrine ,i dont mother mary am trying my best to get it place you ahve always saved me form such big problems and shwo em way ,i fall at ur feet adn depend on your blessing and guidenance to work hard and pls show me way for the same. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,vorgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatening danger vanishes at thy prayer. Amen, Rgds, J.DOminic Vijay Kumar Delhi 2014-07-09
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-09
REJEES ARTHUR Mary Matha i have a good family and two sons with me .but financially so tight .both we have a job but we cannot manage ,i like to stop my bad habits but i cannot stop please prayer for me and bless for the sweet and nice peaceful life for me. My Wife -Sheena PS. 1st son Kesav raj 2nd son Adinath Rejees,Mother Name Vimala FATher Name Arthur Please Pray for me Coimbatore 2014-07-09
Baby Velankanni mathave, I am thankful to Mother Mary for interceding in our prayers . Jesus has granted our prayers. Thank you Mother Mary for being with us every moment ,helping and guiding us. Only by mother's intercession and blessing everything went on smoothly. My son got admission as per God's plan and according to his wish. Please bless us with peace and happiness in future also.Thank you so much.I will visit Velankanni Churh. Kottayam 2014-07-09
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless the journey amma.give me job amma.thankyou amma. varahapatnam 2014-07-09
P Plz ma d should get this job plz we both beg u plz plz plz he finished his interview thx for ur help till here now they have said they will call back plz do miracle that they should call him and he should get call tomorrow please amma please please accept our request Love u ma Pune 2014-07-09
Lona Mendonca Mother Mary,please help me get through the interview today. Help me do well. CENTENNIAL 2014-07-09
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma yesterday my elder daughter 21st birthday,thank you ma for past 20 years you gave good health protected her from all danger and evils.Ma this 21st year give her good health and protect her from all evils and danger.Thank you ma. Auh 2014-07-09
r kathu kollane mathave.koode undayirikkename.please take care of us all.please take care of a, v and me and our little one to come.please be with us and guard us with your love.you are great and powerful amma.through you all things are possible. sc 2014-07-09
p Mother Mary, Please bless me with .NET technology knowledge for my work assignment. Please bless me so that I could understand and learn .NET technology easily. Please bless me so that I become a very good programmer in .NET and I am able to understand .NET projects. Please bless me so that I am able to write code easily for my current and future .NET projects. Please bless me so that I am motivated to learn .NET. Please bless me with this gift of knowledge. Amen i 2014-07-09
p Mother Mary, Please bless me with .NET technology knowledge for my work assignment. Please bless me so that I could understand and learn .NET technology easily. Please bless me so that I become a very good programmer in .NET and I am able to understand .NET projects. Please bless me so that I am able to write code easily for my current and future .NET projects. Please bless me so that I am motivated to learn .NET. Please bless me with this gift of knowledge. Amen i 2014-07-09
SM Please pray for Susan's good health and peace of mind, that Rephsam and Liya becomes well behaved and humble, also that Susan has peace at work and is appreciated, that Helen becomes healthy and loving and eats well. Please pray that the filing is done easily and the trip is very good for three of us, also that Crm co-operates and returns all the dues he owes me and the sale is done easily that Svm deeply cares for me and that Zoey and Rachelsa are fully healed and that DM does well in her interviews. M 2014-07-09
mary durai Dear matha, pls matha to solve my health problem. thank u so much mummy for u r lot of blessing. pls bless me i need a baby. bless safe my life full of u r blessing. THANK YOU MATHA singapore 2014-07-09
Sheeba Amma, We will go to India next week for vacation.But I scared about my husband's family members.Please Amma Please guide me and help me.I don't want any problem with them.I and my children are not interested to meet his sister. Anga oru sandayum varakkoodathu.please Amma. Santhoshama poyttu santhoshama varanum naanga. Kuwait 2014-07-09
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-09
Maria Doss Roche Victor Thanks Madhavee, Thanks for guarding us all the time , Amen Chennai 2014-07-09
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension, help us get agood house, good increment good promotion. Mother please bless my dad of eternal peace. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness. mumbai 2014-07-09
godwin dear mother pls help me to get good job...you gave everything for me and made me feeling happy but waiting for good job for long time pls do a miracle pls amma pls...neenga enaku kodukura anaithukum na nanri kadanpathu irukuran ungaluku edum senjalum adu ungaluku match aagathu na nadandu un aalayam vandu nanri seluthuvan pls pls amma do a miracle pls pls pls am waiting for ur miracle ... india 2014-07-09
mm Ma Good Morning and Thanks Ma, Ma Today my daughter exams, you know it v well and i know you will take care ofit ma. Ma take all my daughters papers to the right hands for correction and excell all her papers. Thanks Ma and Love you Ma. auh 2014-07-09
kavitha henry Mother Mary pls have mercy on me amma pls have mercy on my daughter amma today is her Kannada and English test amma she have to do her test nicely amma pls bless her don't leave her hand amma pls be with her and bless her amma amen. bangalore 2014-07-09
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. HELP ME TO COMPLETE THE COURSE SUCCESSFULLY. ONE VISIT TO VELANKANNI. ONE OWN HOUSE. ONE CAR. BLESS ME WITH CHILDREN. THANK YOU. Tiruchanoor,Tirupati rural. 2014-07-09
MANIYAN PARAMASIVAM amma. i submitted my wants to you so far through this website .. amma. i love you. i stop doing all my bad behaviors if i get all of my wants through your blessings amma. be with me and bless me amma. i need you to be with me and bless me amma. make my mind so active and very smart , give me fast and best problem solving skills, very good mind, i should be able to all the thing at ease. i love you amma. i am extremely sorry for all my bad behaviors amma. amma. i love you amma. i come to you with the hope on you that you will give me all of my wants amma. i hope i got all of them, my dear amma. i will not do these bad things unless or until i not get all my wants and i get disappoint. amma.. i love you up to that i will be good i will continue to do all the good things amma. i will not do bad things amma. just because of you amma. i will be good. with your blessings maniyan paramasivam. surat 2014-07-09
J.Dominic Vijay Kumar Dear Mother Mary, please asve my job and my name with my CEO and my HOD,am really so tensed i dotn know waht will happen today ,my CEO is ther in the head office and i need your blessing and grace to overcoem all my problems and save my job and dignity in the front of everyone. My saviour please give me strenght and confidence to overcome all issues and problems and forgive my sins and forgive thsoe who sin agianst us,my saviour save my jewels and my name and protect me from all kind f problems ,issues and save my job and give me strength and confidence to work hard and show me way for this IPAD probelms ,i haev done a mistake and everyday am dieing pls come to my aid pls let me accept what every is doen by me and am feedup with this gossip and humilation and i odnt haev another job for survial ,mother mary i'll be on roads and please hel me over come all my issues adn forgive me my sins. IN your name am starting this day pls bless me with peace of minf,strenght and confidence and bless all my IT things so that everythign goes well. Pls bless my relationshipw ith my CEO and boss and all my team members so that we dont haev any kind of mistudnertanding adn this will build my image inthis company. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthon ybeloved of god and man pray for us. Everythreatening danger vanishes at thy pryaer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-07-09
GH OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUMBAI 2014-07-09
GANGA HOJIRE OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUMBAI 2014-07-09
GANGA HOJIRE OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUMBAI 2014-07-09
GH OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUM 2014-07-09
GH OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUMBAI 2014-07-09
GH OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUM 2014-07-09
GH OH MOTHER MARY.. MOTHER OF ALL CHILDREN. PLEASE HAVE MERCY ON YOUR CHILDREN WHO ARE NOT FEELING WELL.. MOTHER MY BELOVED HUSBAND IS NOT FEELING WELL AND FEELING WEAKNESS. PLEASE TAKE CARE OF YOUR SON. HE IS ALONE AT HOME. PLEASE HEAL HIM. HAVE MERCY AND YOUR BLESSING ON FIRDOSH MAVJI.. PLEASE I BEG YOU.. AND I REQUEST YOU.. MOTHER YOU ARE THE ONLY HOPE TO ME.. YOUR ARE THE MEDICINE FOR US... KATNI SAMAY PAR TERA HI EK SAHARA HAI MAA... DAYA KAR MAA FIRDSOH MAVJI... AUR DUA DE MAA.......... THANKS MOTHER MARY. AMEN. MUM 2014-07-09
JULIE JOSE Lord Mary "The mother of god" do bless our family and the entire people around us,who are longing for your love and blessings.Dear loving mother,do shower every being with your blessings for their needs and peacefull living.Bless the sick,the poor,the needy,the sinners and even the people who have no faith in you,so that they realise and feel your blessings and love.bless every one with peace,love,health,wealth."Hail Mary" shower your love upon us,for everyone to leave their anger,jealous,sins,laziness.Pour our hearts with your blessngs to live a peacefull and hopefull life.Love you Mother!Praise The Lord!!! coimbatore 2014-07-09
Baala Kunaratnam Thank ou Amma for the mortgage and kindly solve our current financial hardship Amma. Thank ou for doing so. Canada 2014-07-08
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake me and my loved ones. Amen. --- 2014-07-08
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME TO COMPLETE THE COURSE SUCCESSFULLY. BLESS ME WITH A OWN HOUSE. BLESS ME WITH A CAR. BLESS ME WITH CHILDREN. BLESS ME WITH MANY VISITS TO VELANKANNI. BLESS JOBBIN WITH YOUR LOVE,CARE AND EVERYTHING. Tiruchanoor,Tirupati rural. 2014-07-08
Ajay Kodeesvaran I beg you Mother Mary, please give a opportunity to work abroad. Mumbai 2014-07-08
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma thanks for the good vacation, during vacation you protect us from when we traveled by road.Ma thanks for all u done during my vacation. Auh 2014-07-08
Thevaapriyaa Amma please bless Neymar maa.Amma please bless him to recovery soon from vertebra fractured maa.Amma please bless him to walk and run like normal maa without any pain. Amma his dream is to play in FIFA World Cup 2014 Final and be a champion maa.But this injured ended the Brazil star to continue his tournament maa.Amma please bless him and be with him always maa.Amma please make his dream come true maa.Amma today morning 4 o'clock Brazil will play with Germany in semi-final maa.Amma Brazil team is going to play without Neymar maa.They are playing to achieve Neymar's dream maa.Amma please bless the Brazil team to win against Germany and go to final round maa.Amma please bless them to reach final and to win the World Cup trophy maa.Amma please bless the Brazil team to play carefully maa.Amma please bless them to play fair and without any mistakes and bad marks maa.Amma please bless Brazil team and be with them maa.Amma please protect them maa.Amma please make them happy and proud maa.Amma please bless Neymar and his teammates maa.AMEN... Malaysia 2014-07-08
Antony JM " OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma praying for family piece,my wife suspect me that I have illegal relationship with my class mates.Ma show your miracle and prove I am true to my wife and children and do not have any bad connection with my class mate,she must believe me and ask pardon for using unwanted words,if not we have to say bye. Ma you know me I am so kind to my wife and children.Ma now I submit this prayer to you show the way for me ma. Auh 2014-07-08
DP Amma tomorrow D interview plz he should get this job we have sacrificed lot atlest now plz giv us fruit plz its humble request from we both plz accept our request we beg u plz approve our prayers we both beg you for this job please Amma Love you ma mumbai 2014-07-08
SM Please pray that my sister is peaceful and healthy and that her boss and organisation do not trouble her and that she gets a new job and that Anu becomes quiet and responsible. Please pray that Li and her husband never trouble me, that they become more loving and that the filing is done easily and that the trip is very good for all three of us and that crm returns all my dues and the sale is completed to my gain, also that the mf get me returns soon. M 2014-07-08
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-08
kavitha henry Mother Mary pls help Shirin amma and bless her amma pls have mercy on her amma today is her science and grammer English test amma pls have mercy on her amma pls Help Shirin to write her exam nicely amma pls help her amma and be with her only when she writes amma pls have mercy on Shirin and bless her amma amen. bangalore 2014-07-08
mm Good Morning Ma and thanks Ma for all your mercy and blessing on me and on my family. Ma i now ask you to bless my daughter to do all her exams v v well and excel in all her papers Ma. You and your son alone can do wonders and bring us good tenants and help us for the fund for rent Ma. Thanks Ma & I love you Ma. auh 2014-07-08
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone, Nandri madhavee, Amen Chennai 2014-07-08
kunal MOTHER OF GOOD HEALTH , pray for my brother in his studies as he is unable to from nursery class rajgangpur odisha 2014-07-08
kunal MOTHER OF GOOD HEALTH , pray for my brother in his studies as he is unable to from nursery class rajgangpur odisha 2014-07-08
kunal MOTHER OF GOOD HEALTH , pray for my brother in his studies as he is unable to from nursery class rajgangpur odisha 2014-07-08
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful,free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless us get agood full time maid. mother please free avi n me of all worries n tension. Mother bless bless us good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-07-08
kunal AMMA ,MOTHER OF GOOD HEALTH ,pray for my brother rahul as he is unable to study from nursery; pray for my father ,as he takes drugs ;pray for my mother ,as she suffering from blood pressure;AMMA ;please pray my parents and my brother to JESUS;Amen.......... rajgangpur odisha 2014-07-08
kunal AMMA ,MOTHER OF GOOD HEALTH ,pray for my brother rahul as he is unable to study from nursery; pray for my father ,as he takes drugs ;pray for my mother ,as she suffering from blood pressure;AMMA ;please pray my parents and my brother to JESUS;Amen.......... rajgangpur odisha 2014-07-08
kunal AMMA ,MOTHER OF GOOD HEALTH ,pray for my brother rahul as he is unable to study from nursery; pray for my father ,as he takes drugs ;pray for my mother ,as she suffering from blood pressure;AMMA ;please pray my parents and my brother to JESUS;Amen.......... rajgangpur odisha 2014-07-08
Miriam M Mother Mary, cure of my recent illness. I ask you to please help that there should be no second surgery for me. I have experienced so many miracles that you have done my my life. The wonders and works you have done for me though i don't stand worthy.. I ask you please help me.. I want to have a child soon. There is already a delay.. i ask you please answer my prayer. Bangalore 2014-07-08
Miriam M Ma, i ask you to please bless my brother Fabian... Please help him give up his addiction of gambling. I am worried about my niece.. i want her to get a good life.. good education.. Please open fabian's eyes to see his daughter's future.. I have faith you will work through people and answer my prayers.. I don't want my niece to struggle in her childhood.. Please ma.. i know you have sometimes delayed my prayers but you have answered them with much more than what i deserve. Thank you so much for all your blessings .. i need you ma.. bless my family back home.. protect them from all evil.. Amen Bangalore 2014-07-08
Miriam M Ma,please bless my brother Durai.. help him give up his alcohol.. he works hard but help him realize that he has a life ahead and that he should do well in life.. please help me ma.. i am concerned and worried about my brothers.. i want them to do well in life.. they should not trouble my mother who has sacrificed so my much in her life to bring us up. Amen Bangalore 2014-07-08
r mathave thank you for your love and kindness amma.thank you for being with my baby and giving him a happy birthday. amma thank you for protecting him and showering him with your grace.amma i pray for 143 and 154 amma. i pray that i may be able to study well and get good marks in both subjects.kathu kollane mathave.koode undayirikkename mathave.please guard us from all danger and keep us under the shadow of your love. sc 2014-07-08
MANIYAN PARAMASIVAM AMMA. I LOVE YOU AMMA. I SUBMITTED MY WANTS TO YOU SO FAR AND I HOPE I GOT ALL OF THEM , I LOVE YOU AMMA IF I GET ALL OF MY WANTS ASKED YOU SO FAR AND SUBMITTED IN THIS WEBSITE I WILL BE GOOD AND I WILL NOT DO ANY BAD THINGS AMMA. I LOVE YOU AMMA. I NEED YOU TO BE WITH ME AND BLESS ME FOREVER AMMA. WITH YOUR BLESSINGS MANIYAN PARAMASIVAM. I COME TO YOU AND I BELIEVE IN YOU AMMA. I WANT TO YOU BLESS ME FOREVER AMMA. I NEED YOUR BLESSINGS AMMA. IF I GET ALL OF MY WANTS I WILL DO HELP TO ONE OF THE ORPHANS HOUSE YEARLY ONCE AMMA. OR I HELP SOME ONE. I WILL DO IT AMMA. I AM YOUR SON, PLEASE DO NOT TAKE YOUR LOVE FROM ME AMMA. I LOVE YOU . BLESS ME WITH YOUR KIND AMMA. I LOVE YOU. I TRUST YOU MY AMMA. I AM GONNA BE GOOD WITH YOUR BLESSINGS AND I STOP DOING ALL THESE BAD THINGS AMMA. I LOVE YOU. SURAT 2014-07-08
Suresh Thanks Amma for your prayers Bangalore 2014-07-07
Maria Doss Roche Victor Thanks Mother Mary, Thanks for giving us good health , Nandri Madhavee, Amen Chennai 2014-07-07
nisha I AM WORRIED ABOUT MY HUSBAND WE DID LOVE MARRIAGE WE GOT ONE BOY CHILD .NOW HE IS HAVING ADDICTION OF ALCOHOL.PLEASE SAVE HIM WE NEED HIM Delhi 2014-07-07
nisha I AM WORRIED ABOUT MY HUSBAND WE DID LOVE MARRIAGE WE GOT ONE BOY CHILD .NOW HE IS HAVING ADDICTION OF ALCOHOL.PLEASE SAVE HIM WE NEED HIM Delhi 2014-07-07
nisha WE BUY ONE HOME IN DELHI BUT THERE IS SOME PROBLEM IN REGISTRATION PLEASE PRAY FOR US Delhi 2014-07-07
nisha WE BUY ONE HOME IN DELHI BUT THERE IS SOME PROBLEM IN REGISTRATION PLEASE PRAY FOR US Delhi 2014-07-07
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. ---- 2014-07-07
maria raj mother i beg for forgiveness and pardon...pls strengethen my professional life with no hurdles created by srinivas , sarang and other leaders. remove the devil which is creating problems in my professional life mother i beg and ask for justice pls do justice to me and my job...bless and heal me and my husb to stay united in a house you had choosen for us.. and move the barriers created by my inlaws to break our relation .. bless us with ur gift.. a child which would come as a miracle in our personal life. hyd 2014-07-07
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. BLESS ME WITH A GOOD HUSBAND. HELP TO COMPLETE THE COURSE SUCCESSFULLY. BLESS ME WITH A OWN HOUSE. BLESS ME WITH A CAR. BLESS ME WITH CHILDREN. BLESS ME WITH A VISIT TO VELANKANNI. THANK YOU. Tiruchanoor,Tirupati rural. 2014-07-07
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.thankyou amma for blessed prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-07
theresa joseph Please pray for me to amma. I am in very painfull situation in mentaly, phisicalt, and financialy. i am 65. i have no one to help.I want to come to india in this Sept. to amma to full fill my promisess. I am in very bad situation in financially. i have some depth too. last 5 years i dint work because of health problem.pl. Pray for me. I belive amma will help me. theresa. canada 2014-07-07
theresa joseph Please pray for me to amma. I am in very painfull situation in mentaly, phisicalt, and financialy. i am 65. i have no one to help.I want to come to india in this Sept. to amma to full fill my promisess. I am in very bad situation in financially. i have some depth too. last 5 years i dint work because of health problem.pl. Pray for me. I belive amma will help me. theresa. canada 2014-07-07
jj Dear Mother, Please come to our aid. We have purchase a new property and the real estate agent is trying to rob us of our finances. He is trying to cause all sort of problems for us with regards to the purchased land. Mother please help us and save us and our property and see that whatever is ours remains with us . Please solve our problem and turn everything for our favour and our good. Maharastra 2014-07-07
John Dear Mother bless me to construct a house of my own, whatever steps i have taken all in vain with deep sorrow i pray to you to bless me my wife and son with a new home. Mct 2014-07-07
SM Please pray for great changes and peaceful behaviour from Rephsa, Liya and Helen, that Crm returns all dues to me and a peaceful sale, that the filing takes place easily and for Alensa to get perfect scores and for Susan's peace at work and home and her good health and safety. Please pray that Liya and Rephesa calms down a lot and does not cause stress at home and behaves well. M 2014-07-07
Sachi Mother Mary have some mercy on my brother who is digonised with cancer in 2013 cancer spreaded in his liver and other parts of the body please pray for the horible thing to clear fromn his body free him from the illnes he is in lot of pain screm in the night no sleep. What has he done to suffer with this horible decess. we don't want him to suffer. Mother make him calm and peace. Please pray for my brother. AMEN. unitedkingdom 2014-07-07
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.thankyou amma for bless the prawn pond.give me job amma.thankyou amma. varahapatnam 2014-07-07
kavitha henry Mother Mary pls have mercy on my daughter today is computer and social science exam amma she have to write her test nicely amma pls help her and be with her amma when she is writing her test amms pls help her amma she should not leave one question also amma pls bless her and love her when she is writing pls hold her hand amma she should not do any one wrong bangalore 2014-07-07
r kathu kollane mathave.koode undayirikkename mathave.please please please be with amma and help me with compiles and automata.apathonnum varuthathe nokkename amme.father lord, lord jesus, holy spirit,appe, kaval malakhamare, kanyattunirappu muthappanmare please be my side and help me with everything. i pray for aaron as he celebrates his second birthday today.please be with him mathave. please bless him with intelligence, health ,happiness and make him a loving child. keep him safe, happy and healthy.thank you god. ny 2014-07-07
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAIAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-07-07
Vinod Narisetty Mary Matha......Please help my Brother in getting his H1-b Visa, You helped us in lot of problems.... hyderabad 2014-07-07
christy dear ma, what is the problem with us ma.i can't understand. the mtm house was almost set for rent. but at the last moment it was cancelled for 3 times. dear ma help us to find a way for earnings. all our plans are becoming vain. our works are freezed and no new works. dear ma help us to find new works. give us new good customes. dear ma protect us from evil. dea ma give us good health. dear ma help us to find a good party for the rent of both the houses. thankyou very much for all favours received by your health. ngl 2014-07-07
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-07
MIchael D'souza Please mother please help my mother, Tresa D'souza, she is in the ICU in Holy Family Bandra, Mumbai, she is being treated for Kidney stone, but since her infections are not going down, the doctors are not able to perform the lazer operation. Please mother, please help, please cure my mother. Mumbai 2014-07-07
mm Ma Good Morning and thanks for giving me another day Ma. Ma i urgently ask you to come forward for two help that is for house renewal and my daughters papers excell and bless all our near and dear once kit and kin office church community and people around the world. Thanks Ma. auh 2014-07-07
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, peaceful and normal. Mother please bless avi n me good health, make us peaceful free us of all worries, help us in our job,help us geta good house, good increment, good promotion. Mother please bless us sort our family dispute. mother please bless my dad eternal peace, Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness., Mother please bless us get agood full time maid. mumbai 2014-07-07
MANIYAN PARAMASIVAM AMMA. I AM SORRY FOR ALL MY BAD BEHAVIORS AMMA. I REALLY SORRY. AS I TOLD YOU IF I GET ALL OF MY WANTS I WILL BE GOOD AND I WILL DO GOOD AMMA. MAKE MY MIND SO ACTIVE AND VERY INTELLIGENT AMMA. I LOVE YOU. I SUBMITTED MY WANTS TO YOU AMMA. I HOPE I GOT ALL OF THEM. I WANT YOU TO BE WITH ME FOREVER AND BLESS ME TO GET ALL OF MY WANTS AMMA. I LOVE YOU AMMA. I REALLY APOLOGIZE FOR ALL MY BAD BEHAVIORS AMMA. I STOP DOING THAT. I HOPE I GOT ALL OF MY WANTS AMMA. WITH YOUR BLESSINGS MANIIYAN PARAMASIVAM SURAT 2014-07-07
MANIYAN PARAMASIVAM AMMA. I SUBMITTED MY WANTS AMMA. I HOPE I GOT ALL OF THEM. I COME TO YOU. IF I GET ALL OF MY WANTS I WILL BE GOOD AND I STOP DOING ALL MY BAD THINGS AMMA. BE WITH ME AND BLESS ME AMMA. WITH YOUR BLESSINGS MANIYAN PARAMASIVAM. I LOVE YOU AMMA. I LOVE YOU SO MUCH, I WANT YOU TO BLESS ME TO GET ALL OF MY WANTS AMMA. WITH YOUR BLESSINGS MANIYAN PARAMASIAVM SURAT 2014-07-06
maria g d'sa My Dear Mother Mary Thank U very much for being with me for 50yrs and today is my Birthday bless me with shower of blessings and be with me forever in my smile and in my cry Please Mother Mary help me and my Sister in tomorrow case matter it should be in my favour please grant me the favour I am all ways your child. mapusa goa 2014-07-06
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatunna ella budhimuttukalum maati saukyam tharaname,athodoppam ente visa expiry aakunathunumunpe daivathinte naamathil athbutham pravarthichu nallaoru joliyil praveshippan edayakaname...Athodoppam enneium ente Pappa,Mummy,Anishcan,Remiya Chechieum ashima moleum thirumunppil samarpikunnnu.Aapathil Ninnum anarthgalil ninnum rogathil ninnum viduvichu kaathukolaname...Amen UAE 2014-07-06
antony amma velankanni mathave,first i thank you for give this valuable life..i got a job in big mnc for you..now i have exams in my company..if i cleared the exam i will go permanent position..already i failed in one exam.i am very fear now..please pray for me..please bless me..amma i strongly believe you.i expect you will make miracle in my life..amma please help me..i beg you..amen coimbatore 2014-07-06
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-06
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-06
r kathu kollane mathave.koode undayirikkename. thank you for your love,kindness and grace.i surrender my life in your hands amma.please help me and be with me all the days of my life. i surrender everything in your hands amma. ny 2014-07-06
Kumud Mother Mary pls help me to save Kalpesh & his wife .mom pls pray for them love each other ,live in faith & confidence forgive each other .god bless their marriage life .mom heal them & their child mom thanks for your matnerl care. Amen Anand 2014-07-06
SM Please pray that Rephsam does not fight at home and that she becomes calm and kind and unselfish, please pray that she changes completely and does not stress out anybody at home, please pray that Li,Man and Math love me and do not give me any trouble, that Li is warm and co-operative and never fights at home or is unkind to me or smv. Li is good during this trip and the filing is done easily also that crm returns all my dues fairly and quickly, that the sale is easy. M 2014-07-06
maniyan paramasivam amma. i am sorry for all my bad behaviors i did so far amma. i am sorry amma. i will be good amma. i come to you and asking for help. if i get all of my wants i will be good and i stop doing all my bad behaviors amma. i will not do these bad things unless or until i get disappoint and i not get my wants. if i really get all of my wants submitted you so far through this website and asked you so far i will be good. i stop doing my bad things amma. be with me and bless me amma. with your blessings maniyan paramasivam. i come to you and seeking your help to be good . i hope i got all of my wants and i am going to be good because i got all of my wants amma. i love you . surat 2014-07-06
kavitha henry Mother Mary pls have mercy on my daughter what and she leaned pls keep her in the mind amma you be with her amma pls bless her and help her amma she have to do in her exam well amma nothing she should forget amma today is her maths and dictations 50 words amma every thing she read but she have to not forget any thing amma when she is writing her exam pls be with her amma bless her with your love nothing should forget amma pls pls amma love her amma we need your blessing always amma for my family amma ,,, pls help me to take all my golds back amma pls help me soon I have lot of money problem amma I do no to whom I can ask amma you only suggest me one good person amma to ask the money to take out all my golds amma pls pls listen to my prayer amma and bless me with your love my interest is too high amma pls amma bless me and help me amma. bangalore 2014-07-06
JS My mother most kind, mother of my Lord I pray to you today to pray to our God for my children. Please help us to find suitabe spouse for my dauther and son,. Our God's ways are beyond our imagination.I believe My God will never let my family down. Please our loving mother I have no one but you who can intercede for us. I beg you to pray to God Almighty for us and bless us with good life parteners for my children. Praise the Lord. Australia 2014-07-06
maniyan paramasivam amma. i love you. i submitted my wants to you through this website and asked you so far amma. i hope i got all of them amma. i love you amma. be with me and bless me amma. i need you to be with me and bless me amma. i love you so much, i want you to be with me amma. i love you more and more amma. i love you. i want you to be with me and bless me amma. make my mind so perfect and very lucky, very brilliant and intelligence, getting good name from everyone, very good memory power, never do mistakes or wrong, very healthy, very successful, very fast and best understanding ability, very fast and best acquiring skills, amma. and all my wants i submitted earlier in this website amma. i hope i got all of them amma. be with me and bless me amma. with your blessings maniyan paramasivam. i hope for it. i believe it, and i will stop doing these bad things, and you may also believe it, i will not do it if i get all of my wants, amma. i love you. i trust you amma. do not take you love from, i want your blessings always amma. surat 2014-07-06
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone in this world, Thanks for giving us the Holy Spirit, Thanks for Blessing my Family , Thanks for blessing Margret , Alfred & Leonard. Thanks for blessing my Mum , Brother and his family . Amen Chennai 2014-07-06
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us get a good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please free avi n me of all worries and tension. mother please bless avi n me good health n job satisfaction. mother please bless my family peace n happiness mumbai 2014-07-06
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-06
stephen c Dear People of God, Please pray to Jesus and Mother Mai to bless all my work for this week and do not allow any interference from any other department. Thank you Jesus Praise you Jesus Love you Jesus. Servant of Jesus-stephen Mumbai 2014-07-06
mm Ma Good mornig Ma, Ma i thank and praise you always for your great favour and blessing on me and on my family members friends company kids all. Ma, Now i humbly and urgently ask to bless my daughter to do her parctical exams v v well and take all her paper to the right hands and excell her i have deep faith you and yur son alone can do wonders and you will do it. Thanks Ma bless me today. auh 2014-07-06
ancy velu Pray for in our home every day fainting happend pray for happiness in one home bless in our home pray for my mother he not well pray for my son my wife & me & for everybody how in different amen. kalyan 2014-07-05
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake me and my loved ones. Amen -- 2014-07-05
ALBERT SUMART AMMA WE PLANNED TO COME TO YOUR SHRINE ON FIRST WEEK OF AUG 2014 BUT DIFFICULT HAPPENED AND WE PLANNED TO COME AT THE MONTH END REQUST YOU TO PRAY FOR OUR JOURNEY. chennai 2014-07-05
r kathu kollane amme.koode undayirikkename amme.amma i thank you for all the love and kindness amma. amma i pray for 143 and 154.kathu kollane amma. i surrender everything in your hands amma. c 2014-07-05
chithra matha i love you amma.. lot of thnks to u for your grace in our daily life.. amma first ofall i give my whole family in to ur hands.. for ur whole blessings amma.. amma you see our sarath.. it is affected and sick very much matha pls cure it.. and do the best for him.. immediately dont leave him to suffer in bad pain and illness.. please bless him matha cure him pls.. matha today morning 4o clock i saw a dream.. it was so bad.. and i frightened about that.. that is very bad matha.. that is not happened us for any day in our life.. matha please save us from the hands of satan.. please bless us my whole family.. do best and miracles in our lives.. matha love us and protect us always with ur love.. amma matha engalukku no money no relatives to help we only have u and our to help and all.. amma if the God be with us nobody can fight us.. matha we need u and ur blessings in our whole life.. mathaa amma hlp us pls.. matha bless my sister and her husband and their baby.. give them ur whole blessings.. amma bless the baby.. give them good health, growth, long life, knowledge wisdom, god fearing and alla good habits and manners.. and teach him from the womb.. give my sister safe delevery.. and bless them with good blessings, health and bless their job and business.. deliver them from evils and give more growth to their lives.. bless them.. bless my thampi.. give him more blessings.. long life to him.. give him ur love peace.. give him promotion in his job and growth in salary.. bless him with a good life partner.. show him ur power and miracles.. strengthen himm and always be with him.. matha bless my parents.. give them your blessings.. long life good health,protect them from all evils.. bless them be always with them.. plese deliver from all debts..bless my parents amma ungla udanituppai eppodum engalukku tharum.. nanatri.. thank u matha thank u matha thank u matha.. kanyakumari 2014-07-05
chithra amma mathave.. varum umathu kirubayaum irakkathayum tharumm thaye amma bless us all matha.. bless our needs.. matha.. bless our jobs.. matha be with us matha i love you thaye.. amma en daughter shana.. 2 1/2 years old bless her matha.. you bless her from my womb.. i know.. you showw me before she produce.. amma you bless my shana.. give her your blessings, guide, ana protection.. pls amma give her strength long life amma good character good knowleds, good habits and manners throughout her life.. bless her with good health.. love and peace.. amma bless her with wisdom and knowledge.. bless her with arise and shine..bless her with all good qualities in her life.. love her matha bless her matha guide her matha.. protect her matha.. give her good and high eductation.. thank u matha bless her matha thank u matha.. kk 2014-07-05
chithra ammma thaye thikkatravarkalukku aruthale.. amma bless me and my husband with unity.. peace and love matha.. matha i'm seperated with my hus for last 2 years.. he doesnt like me even he doesnt want me also.. mathaplease bless my hus mind.. please give pity to my husband.. amma i love him and i need him.. but he diesnt.. amma pls bless him and change his mind and please give us miracle in our life.. amma please speak to my husband.. amma please amma give us a good life and bless us .. matha amma change my mother in law's and fatherin laws mind bless them .. give them good health.. amma make them love upon me and my baby.. amma i need my hus maama and maami..please bring them to me.. immediately.. i need their love.. please matha.. bless us bless me matha.. elevate me with your blessings.. give unity love and happy among us.. do kiracle in my life.. i love you.. i expect great miracle in my life.. thank u matha kk 2014-07-05
henry mother mary thanks so much for all the admissions happened in this month . my office should be always busy with admissions and enquiries.we should have a good business this month. kindly bless my family with good health and prospects.amen. ave maria. bangalore 2014-07-05
LOUIS RAJ CRUISE LINE JOB SELECTION MY MOTHER CECELY FATHER SUSAIRAJ TO GOOD HELTH CONDITION THANKS AND REGARDS LOUISRAJ AVE MARIA CHENNAI 2014-07-05
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma praying for own house,we are planning to buy land and build house,ma help us to buy the land for this we required loan ma, please help us to get loan and buy the land and build house ma, show your miracle on us ma, help us ma.Thank for the good vacation,during vacation the help you done to my family and thanks ma the new salary I received.Thank you ma. TVC 2014-07-05
S Dear beloved mother Mary, mother please help me , mother please save me from all the tensions and stress I am bearing now, mother please help me , mother as I am not feeling well , I am suffering from severe wheezing, mother I unable to breathe , mother I am totally sleepless and restless , mother became very weak mother have no strength to do any work, and I have a all child to take care of , mother please heal me , mother touch me now and heal me mother have mercy and heal me mother , mother do miracle and heal.me now, mother heal me totally whatever bothering me mother and bless me with good health peace and happiness forever , mother please come to me now mother i need you mother ,please help me mother, please I beg you mother please hear my cry now mother help me now other please respond to my prayers now mother, mother please come into life now mother hold me heal me change me and strengthen me,mother please I beg you mother hear my cry now and answer to my prayers now, mother Please respond to my prayers now , mother as know due to my marriage issue, my dad left me totally , since 7th are I an living far of my parents and hone mother , mither please soften my dad heart now and let him allow my mom and all my family to keep contacts with me and accept us and allow me my husband and my child to home, mother do miracle now and reunite us with my parents and home now , mother please answer to prayers now and bless me and my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-07-05
mm Ma Good Morning and thank you for all your blessing and graces on me and on my family Ma. Ma, now i ask you to take your self all the exam papers of my daughter to the right hands and excell her in all her papers. Ma please heal the syst in her as you are a good doctor. bless my niece with a suitable life partner and bless my sister and mom and us with good and healthy life and bless us with this job espically my husband. help us to clear all our debts and loans and give us a blessed home auh 2014-07-05
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME A GOOD HUSBAND. BLESS ME A GOOD HUSBAND. BLESS ME A GOOD HUSBAND. ONE VISIT TO VELANKANNI. ONE OWN HOUSE. ONE CAR. TWO CHILDREN. Tiruchanoor,Tirupati rural. 2014-07-05
kavitha henry Mother Mary pls have mercy on me amma bless me love me amms pls help my daughter in her study's amma she have to write her exam nicely amma good amma she should not forget any thing amma pls have mercy on her amma always be with her love her amma And pls bless my son also amma love them he should be very smart and active amma and pls improve my office amma there should be more admission amma already 8 months over amma pls have mercy on us amma so much of credit amma that you no very well about my problem soon solve all my problems amma andi have to take all my golds back soon amma pls love me and help me for the money amma my I interest is more and more amma pls do me some thing and help me amma I have to get more admission amma ,and soon I should get one nice job in good company with good payments amma Saturday half day or full day holiday I should have amms so o can go and sit in my office on Saturday amma pls have me amma I should get a good job with out any certificate amma pls pls amma help me and bless me amma and I should not put too much of weight amms I should be fit and silm and I should maintain the weight of 55 kg amma pls pray for me and bless me amma Soon solve all my problems and give me price of mind amma soon I should buy a car for my office amma soon presently I have one car soon I should buy second car santro amma pls have mercy on me and bless me amma love me amma pls pls because of me pls pray to Jesus Christ amma tell to solve all my problems amma amen bangalore 2014-07-04
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-07-04
Prasanna Kanojia O Mother, Thanks for everything that is given to me. I pray to you to give me a healthy and peacful life. Bless my child to be grow as a humble and nice person. Bless me with a healthy and blissful married life.Please keep my parents good in health. Show and Give me all the opportunities to do the best for my family. Always show me a right path to walk and give me enough understanding . O Mother i really feel worried and upset today with few difficult situations fallen in front of me. Help me and husband by giving enough wisdom to sort it out. Please bless our entire family so that there occur no dispute or misunderstanding. Mumbai 2014-07-04
VIJAYALAKSHMI BULLA Mary Matha please help me with you powerful prayer to lord Jesus. Please help us to get my husband (Mr. Srikanth Kosuri) salary properly along with pending salary. My husband looking for a change in his job, so pray for my husband to get a new job, also to increase our financial status. Pray for my son in his studies and give good health & wealth. Mary Matha please help in our health problems, financial problems and give us the strength to face them successfully. Please bless my husband, my son, parents, sister family and brother family too. Pray for me and bless me amma. Mary matha please pray for me to continue in this job with out any problems. Please help us and give the strength to face each and every problem whatever we will get. Mary matha please give the peaceful life to us and take away all the problems from us. Please pray for me (Mr. & Mrs. Srikanth Kosuri) and my family too. Thanks for your prayers. Hyderabad 2014-07-04
Daughter Dear,, nambi nalladhu panna oru familyku ana avanga motha perum enna romba kashta pauthittanga. Oru masam achi innum ennala thanga mudila azhudhu azhudhu thanga mudila. Yar kittavun sollavum mudila en vethanaya purinji enakaga help pannunga plsssssssss plsssss Chennai 2014-07-04
tp OH MOTHER DEAR PLEASE HELP MY DAUGHTER TO COMPLETE HER LAW STUTIES IN GOOD MANNER. MY WIFE IS SICK & TIRED. HELP HER TO KEEP GOOD HELTH. HELP ME TO RECOVER ALL THE LOST MONEY IN SHARE. HELP ME TO GET GOOD BUSINESS IN MY PART-TIME BUSINESS. HELP ME TO FULL-FIL ALL MY OFFICIAL DUTIES DELIGENTLY. GIVE MY DAUGHTER A HEALTHY CHILD WITHOUT MUCH TRUBLE. HELP ME TO IMPROVE MY FINANCE. HELP THE GIRL WORKING AS MY ASSISTANT TO FIND A SUITABLE BOY. HELP MY BOSS TO FIND A SUITABLE BOY FOR HIS ELDER DAUGHTER HELP MY TO ACQUIRE THE 50% SHARE OF MY HOUSE AT NATIVE PLACE. GIVE MY SON-IN LAW & HIS PARENTS AND RELATIVES GOOD HEALTH & FORTUNES. GIVE ME ENOUGHT MONEY, SO THAT I CAN HEL THE NEEDY & MY FRIENDS. HELP MY RELATIVE GIRLY TO RECONCILE WITH HER HUNBAND. HERP HER HUSBAND TO ABANDANDON HIS DRINKING HABITS. YOUR SON TP mumbai 2014-07-04
carol Dear mother, please bless my son with a job at the Harbour Marriott as a bakery chef manager.help him to get good scores in collage.Help us with good health and peace at home. mumbai 2014-07-04
r kathu kollane mathave.koode undayirikkename mathave. i pray for my parser and atta today amma.please be with amma.thank you for the love and kindness yesterday amma. sc 2014-07-04
stephen c Dear People Of God, I thank very very much Jesus,Mother Mai and you people of God for all the blessing, petitions and grace i received during this week. Thank you Jesus praise you Jesus love you Jesus. Servant of Jesus -stephen Mumbai 2014-07-04
MBV Dear Mother, my elder son (Krish) is suffering from hearing loss, please grace him so that he can hear just like a normal child without any Hearing Aid or Operation and my younger son (Kush) is not able to speak properly even though he is 2.11 Years Old also please grace him so that he can speak properly. Please bless both of my children. Vapi 2014-07-04
Krd Maa Arjun ni intiki thesukuvacharu thalli. Inka fever rakunda chudandi thalli. Sampurna arogyanni prasadinchandi amma. Vadi parents baga alasi poyi vunnaru amma. Vallaki santhoshanni ivvandi. Maa rohan ki kuda pigmentation problem thaggi normal ayyetatlu bless cheyyandi thalli. Meeku vel vela kruthagnatha sthutulu amma. Ninna vachi chudali thalli. India 2014-07-04
mahesh Dear amma please bless my family.bless prawn pond give them good health. varahapatnam 2014-07-04
2014-07-04
SM Please pray that RSV has a safe and happy journey with no problems on reentry till she reaches home, that Liya is happy and comfortable about me and is warm that the trip goes smoothly and very happily, that the filing is done easily and bday is happy that crm gives the sale amount due to me immediately and does not ask me for m assistance also that SMV loves me truly and nothing from the past disturbs us. Please pray that KA gets her visa immeditely. M 2014-07-04
mahesh Dear amma pleasebless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health.give me job amma.thankyou amma. varahapatnam 2014-07-04
Maria Ave Maria!! Mother Mary I am keeping fullfaith on you. I am all alone in life searching for my better half. Please help me in finding my better and I am in love with a person and I want him in my life. But there are many problems in that I dont know what to do and I am totally confused please guide me in the correct path. Should I wait for the person whom I love or should I go ahead with my life. I keep full faith on you Mother Mary. Please help me in solving this so that I can have a normal and happy life like others. My friend is also facing difficulties in finding the life partner please help her as well in her life. I keep full faith on you. Thanks for all the blessings that you have showered upon me. USA 2014-07-04
Maria Ave Maria!!! Mother Mary in recent days I have lots of problem in my life. And with that now I have lots of hair fall and it has become very thin. Please help me so that I have hair growth. I have full faith on you. Ave Maria!!! USA 2014-07-04
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-04
jennifer Dear mother, thank you mother very much for this day and for all the favours granted. Mother please blessus blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child.Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, helpus get agood house, good increment, good promotion> mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. mother please bless my family peace n happiness mumbai 2014-07-04
2014-07-04
Suma Today at 11:04 PM URGENT PRAYER REQUEST FOR SUMA --------------------------------------------------------------------------------------- This prayer is for Suma. Suma is taking medicine for diabetes, kidney problem, and Cholestrol. Suma had a complete blood test and Urine test today July 3rd Thursday. Please pray that Suma's complete blood test result and complete Urine test result and all other test doctor authorized will become completly Normal by your Prayer. Please pray that Suma's blood sugar test result and Liver test result and Kidney test result and cholestrol test result and all other blood test result and all Urine test result will become completly Normal by your prayer. usa 2014-07-04
Suma Today at 11:04 PM URGENT PRAYER REQUEST FOR SUMA --------------------------------------------------------------------------------------- This prayer is for Suma. Suma is taking medicine for diabetes, kidney problem, and Cholestrol. Suma had a complete blood test and Urine test today July 3rd Thursday. Please pray that Suma's complete blood test result and complete Urine test result and all other test doctor authorized will become completly Normal by your Prayer. Please pray that Suma's blood sugar test result and Liver test result and Kidney test result and cholestrol test result and all other blood test result and all Urine test result will become completly Normal by your prayer. usa 2014-07-04
Suma Today at 11:04 PM URGENT PRAYER REQUEST FOR SUMA --------------------------------------------------------------------------------------- This prayer is for Suma. Suma is taking medicine for diabetes, kidney problem, and Cholestrol. Suma had a complete blood test and Urine test today July 3rd Thursday. Please pray that Suma's complete blood test result and complete Urine test result and all other test doctor authorized will become completly Normal by your Prayer. Please pray that Suma's blood sugar test result and Liver test result and Kidney test result and cholestrol test result and all other blood test result and all Urine test result will become completly Normal by your prayer. usa 2014-07-04
Tarika Selvam Mother Mary Please have mercy on my father and solve all his problem and help him to get back his money. Hpoing for the good results amma. Bangalore 2014-07-04
christy amme madhave, hear the cry of ur daughter ma. i am helpless. customers are coming but not finalising. people are coming for the new house. but not fixing. people are coming for rent. but not till the last step. as a result .. no new works, no rent, & not yet sold the new house. dear ma do something else to help us i need ur ngl 2014-07-03
Christina OBrien Most Holy Mother, I beseech you to cover with your mantle of protection my cousin Maria who is pregnant but has chicken pox, pray that she is healed and the baby is safe & healthy. We have always had your protection dear Mother, once again we ask for you to please obtain this special petition for us. We believe in your Most Holy Son Jesus who is our merciful & kind God, He is our Saviour, healer, our Everything. Hear our prayers & obtain our petitions. Thanking you in advance for your blessings. Dubai 2014-07-03
Antony Francis Fernandez That my daughter Cassandra Fernandez will be completely cured. Kuala Lumpur 2014-07-03
SANKARAN SOMU PILLAI Oh mother, my friend sunil chummar's child of 2 and half years is suffering from jauntice since past few days and unable to take any food. he is under naturapthy. please help him to comeback to normal and make his parents happy. your blessings only can can cure the baby fast. I earnestly seek your kind blessings for the child and his parents. MUMBAI 2014-07-03
carol Dear mother, I ask of you in deep faith to please bless my son with a job at the harbour marriott as a bakery chef manager. please help him with good health help him to do well in his studies.please bless us with good health. mumbai 2014-07-03
Liza My dearest mother.... I am so worried... Pls change my friend ... Klmsr 2014-07-03
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-07-03
Molly My self and my families health and well being . About my daughter nisha's wedding to a good,god fearing boy. Madikery 2014-07-03
Molly Please pray for myself and for my family Madikery 2014-07-03
Beyline Mama mary thank you so much for giving me good marks for my M.Phil Exam .Praise you Jesus Thank you Jesus.Crores and crores of thanks i couldnt even believe that i got this much marks. kollam 2014-07-03
r kathu kollane mathave.koode undayirikkename mathave.mathave i pray for my meeting with sean today.please let it go well amma.please let him allow to my plan amma.please make him say yes to my exam proposal.kathu kollane mat have.koode undayirikkename mat have. father lord, lord jesus, holy spirit, kaval malakhamare, kanyattunirappu muthappanmare, appe, st jude appacha, st antony appacha, archangel gabriel malakhe kathu kollane.please please please be with me and save me.please make him say yes. anything is possible if you wish it lord.please please please help me amma amma.please make a miracle happen.kathu kollane mathave. sc 2014-07-03
rahul Holy mary mother of god please pray for me...for a better job i got a good offer please make it a success. Holy mary full of grace you are my belief my mother... Please pray for me I pray as per Matthew 7:7- amen HYDERABAD 2014-07-03
JPR Ente amme ashrayame. Njangal orupadu thavana karanju prarthichu njangalude makanu padikkan nalla bhuddhi kodukkane ennu. Ippol avan padikkan ishtamillathe college vittu poruvan theerumanicha pole ayittundu. Njangalude oru swapnam ayirunnu makane padippichu valuthakkanam eenu, athilude njangalude uyarcha undakanam ennum karuthi. Ippol ellam thakarnna pole aayi. Ente manassinte bharam njan evide irakki vekkum amme. Etra padichittum avante thalayil kerunnilla ennanu parayunne. Ithil ninnum oru mochanam ille amme. Njangal muttippayi prarthichathinu kittiya phalamano amme ithu. Njangal hridayam potti karanju kondanu ammayodu chodikkunne. Ente jeevithathile sambhadyam muzhuvanum njan avante padippinayi neeki vechu. Ithano amme njangalkku kittiya swanthanam. Njangalude vedana onnu matti tharille amme. Njangalude makanu nall bhuddhiyum, shaktiyum, kazhivum kodukkane amme... Please.. ammayode njangal yachikkunnu. Enthu thettu aanu amme njangal chaithathu. Entu prayachitham aanu cheyyandathu. Njangalude makanu Engg padichu nalla mark kitti pass akan kaniyaname amme. Mattu chintakalil ninnu avane pinthirippikkename amme. Vilichal vili kelkatha ammayallallo. Makkalude vishamam amma kanunnuvallo.. Njangalodu kanivundakaname amme.. Orupadu prashnangalku naduvil aanu amme. Sambhathikamayum, sareerikamayum, maanasikamayum aake njan thakarnnu poyi amme. Onnilum ippol sradhikkan kazhiyunnilla amme. Munnottulla njangalude jeevitham engine anennu polum ariyunnilla. Kathu rakshikkaname amme. Muttippayi prarthikkunnu. Njangalude makane amma kathu kollumennu vishwasikkunnu. Prarthanyode ammayude makan. sec'bad 2014-07-03
Evon Dear mother thank you for whatever I have in my life before even I can ask you, you have blessed me with all happiness. I request you please hear my prayer and bless me that I get married to the person I am in love with. Please help me and my partner to face all the troubles. I will come to your feet and thank you after he and I get married. Please hear my prayer. kuwait 2014-07-03
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensions and stress I am bearing now, mother as I am not feeling well , I am suffering from severe wheezing , mother I am unable to breathe, mother became very weak ,have no strength to do any work, and i have a small child to take care of ,mother please heal me, mother touch me and heal Me Now mother, mother come into my life now mother hold me heal me change me and strengthen me mother, mother please come to me now I need you mother please help me mother, mother be with us always mother,please I beg you to please help me mother, mother please heal me ,mother have mercy and heal me,mother do miracle and heal me , heal me totally whatever bothering me mother and bless me with good health peace and happiness forever , mother as u know due to my marriage issue , my dad left me totally,and restricted my mom and all my family not to keep any contacts with me , since 7years I am living far of my parents and home ,mother please help me mother I beg you to please have mercy and reunite me my husband and my child with my parents and home, and please let my dad allow my mom and all my family to keep contacts with me and allow us to home,mother please hear my cry and please answer to my prayers and grant my prayers mother, mother please respond to my prayers now mother and reunite us with my parents and home and bless Me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-07-03
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensions and stress I am bearing now, mother as I am not feeling well , I am suffering from severe wheezing , mother I am unable to breathe, mother became very weak ,have no strength to do any work, and i have a small child to take care of ,mother please heal me, mother touch me and heal Me Now mother, mother come into my life now mother hold me heal me change me and strengthen me mother, mother please come to me now I need you mother please help me mother, mother be with us always mother,please I beg you to please help me mother, mother please heal me ,mother have mercy and heal me,mother do miracle and heal me , heal me totally whatever bothering me mother and bless me with good health peace and happiness forever , mother as u know due to my marriage issue , my dad left me totally,and restricted my mom and all my family not to keep any contacts with me , since 7years I am living far of my parents and home ,mother please help me mother I beg you to please have mercy and reunite me my husband and my child with my parents and home, and please let my dad allow my mom and all my family to keep contacts with me and allow us to home,mother please hear my cry and please answer to my prayers and grant my prayers mother, mother please respond to my prayers now mother and reunite us with my parents and home and bless Me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-07-03
sarada Our lady of good health mother Velankini, Please take care of our travel to INdia, particularly trying to visit your place. Please take care of our relationships with everybody and be with us always and save us from all dangers, evil spirits and bad situations. Thank you so much for taking care of my medical test and other issues. Please be with us when we travel to India and pay my dues and fulfill my wishes. Please listen to my prayers. Give us good health, pleasure, happiness, most important, faith and trust on you and lord Jesus forever. We shouldn't loose trust on you and take care of usforever in this life. Please forgive my mistakes and sins. I should be able to visit all places whatever we planned with no complications. We should come to you and get your blessings. Show your miracles in our life. You are my only helper, lord, saviour, friend and god. Please have mercy on us. I cannot have more problems in this life. I am tired with all the problems that I am going through. Show your guidance, put us in right direction and give us some light in our life. THank you so much alleluigh, Alleluigh, Alleluigh. Ave Maria, Ave Maria, Ave Maria TX 2014-07-03
PD Hey Ma very Sorry posting very late still waiting for positive reply please ma its a beg v owe our 15 days by not talking to eachother no messages no calls we wanted to owe something precious for both of us nothing is precious thn this plz accept this small gift from both of us and plz bless D with job his inerview is on 9th July his job is important for both of us we seriously want to spend happy moments with each other his job is important for kids better future plz help us in this test and also ma plz help to fight eith the negative thoughts plz forvie me for every thing. Love you lot ma Mum 2014-07-03
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-03
vino pray for my family Pease and pay for the family's those who have in the same situation, let go into pease and joy. our lady of health Velankani pay for us. Chennai 2014-07-03
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy and healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful,free us of all worries, help us in our job, help us get agood house, good increment, good promotion. mother please bless us sort our family dispute. Mother please bless my dad of eternal peace peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness mumbai 2014-07-03
Maria Doss Roche Victor Thanks Madhavee, Thanks for blessing our health, Thanks for strengthening my spinal & muscles, Nandri Madhavee, Amen Chennai 2014-07-03
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,HOPE YOU WALK ALONG WITH ME ALL MY WAY AND GUARD ME AND COMPLETE THE COURSE SUCCESSFULLY. BLESS ME WITH GOOD HUSBAND. BLESS ME WITH GOOD HUSBAND. BLESS ME WITH GOOD HUSBAND. ONE VISIT TO VELANKANNI. ONE OWN HOUSE. TWO CARS-INNOVA,DZIRE. ONE GOOD JOB WORTH-Rs:50,000 PER MONTH. SETTLE ME IN CHENNAI. BLESS JOBBIN ALL THROUGH HIS LIFE. Tiruchanoor,Tirupati rural. 2014-07-03
MANIYAN PARAMASIVAM AMMA. I AM SORRY FOR ALL MY BAD BEHAVIORS I DID SO FAR AMMA. BE WITH ME AND BLESS ME MY DEAR AMMA. I SUBMITTED MY WANTS TO YOU SO FAR AMMA. IF I REALLY GET ALL OF MY WANTS I WILL START DOING GOOD AND I WILL NOT DO THESE BAD THINGS AMMA. I HOPE I GOT ALL OF THEM. I LOVE YOU AMMA. I LOVE YOU . I JUST BELIEVE IN YOU AMMA. IF I GET ALL OF MY WANTS ASKED YOU SO FAR AND SUBMITTED IN THIS WEBSITE I WILL BE GOOD AND I WILL NOT DO THESE BAD THINGS AMMA. I WILL START DOING HELP ALSO. ALL PROUD IS FOR YOU ONLY AMMA. I LOVE YOU AMMA. I SUBMITTED MY WANTS AND I HOPE I GOT ALL OF THEM AMMA. I LOVE YOU AMMA. BE WITH ME AND HELP ME AMMA. I KNOW I WILL BE NO.1 MEDICAL PHYSICIST AND VERY TALENTED PERSON IN THE WORLD. AMMA. MAKE MY MIND SO ACTIVE AND VERY SKILLFUL , VERY FAST AND VERY CLEVER AND WISE AMMA. WITH YOUR BLESSINGS MANIYAN PARAMASIVAM. surat 2014-07-03
Krd Maa please na grandson Arjun ki fever complete ga thaggela chudandi. Last 3 nights inchi high fever thaggatam ledu. Hospital lone vunnadu inka. Ma meeda daya chupi thondaraga thaggi discharge ayyi valla intiki kshemanga cherchandi thalli. Chala alasi poyamu amma. Maaku nee sahayam kavali thalli... Meeku enno kruthagnatha sthutulu chellinchu kuntanu thalli. India 2014-07-03
rosely ouseph Dear Mother Mary please pray for my family members and protect them from all evils and enemies and give us good health,Oh Mary my son has gold loans from bank last 2 years,to get free from his loans ma please pray for him. kerala 2014-07-03
jikku ammae maathaave.. entae ullilae snkdaum dheshyavum ellaam maatanae.. maduthu ammae... enikku ariyilla... enikku bayankara sankadam varunnundu.. ammae maathavae.,.. ammayku ellaam riyaaalo.. i donno at to do .. pls help me ammae... pls clear my thoughts... pls ammae... ammae maathavae.... kerala 2014-07-02
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. ONE OWN HOUSE. ONE CAR. Tiruchanoor,Tirupati rural. 2014-07-02
christy dear ma, our mtm house is set for rent. thanks a lot. atleast the housing loan will be done by the rent.pls help us to find a party for the old house too so that the loan may not be a burden for us.thanks a lot my dear mother thanks a lot for the favour. ngl 2014-07-02
MOBIN MATHAVE I NEED ALL YOUR BLESSINGS NOW I AM IN DEEP TROUBLE SO I NEED YOUR PRESENCE IN MY LIFE EVERY TIME I HAVE SOME DISEASES SO I NEED PRAYER I MAKE SOME ORPHANS TO MARY THE DISEASE MAY COMPLETELY GONE FROM MY BODY I COME AND DOING THAT ORPHANS KINDLY PRAY FOR MY LONG HEALTHY LIFE TRIVANDRUM 2014-07-02
MOBIN VELANKANNI MATHAVE ENTE JEEVANE MARANATHIL NINNUM RAKSHIKKANE NTA 2014-07-02
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake me and my loved ones. Amen. --- 2014-07-02
ANNATHURAI KANNIAPAN mother mary your are gretest mother in my life what i pray it will get mother i pray for dauter to get well the fever and pray to mother mary when they take my dauter blood for test i pray for the blood must good and 10 pm the and the docter told me all ok nothing problem thanks mother my family will be on august month for mother praying .mary mother kuala lumpur malaysia 2014-07-02
Molly Mathew My self and my families health and well being.about my daughter nisha's wedding to get a good boy Madikeri 2014-07-02
SM Please pray that all goes well for me today, that the discussions. are peaceful and fruitful for me, that immediately tickets are booked for the filing journey and Sunny comes for the filing and that his daughter doe not trouble us ever and is co-operative, please pray that today I get very good news. Please pray that Liya does not fight and helps us a lot today. Please pray that God helps me and that Liya does not trouble me and Sunny truly loves me and for RS's safe and happy journey fully. M 2014-07-02
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing my phone, Thanks madhavee, Chennai 2014-07-02
jayaprakash s Velankanni matha i will pray with you please matha help me . I am working in bahrain not salary . heart problem . i will bank loan i want come back kerala. I want good job also. my sponser mind change matha please matha help me. 00973367959585 2014-07-02
r kathu kollane mathave.koode undayirikkename mathave.please please please be with me amma and help me with my meeting today with sums,scpdand sean.please let things work out.please make remote testing possible.kathu kollane mathave.father lord, lord jesus, holy spirit, archangel gabriel, appe,kaval malakhamare, kanyattunirappu muthanmare, st antony apacha, st jude apacha kathu kollane.please be with me and help me in todays meeting .bless me amma. sc 2014-07-02
John Kottoor Dear Mother, Please pray for faster recovery of my father Johny Kottoor who's seriously ill in ventilator due to lung infection in the Hospital at Kochi Kerala. Kochi 2014-07-02
jojo amme mathave ente nenjupotti povunna vedhana ane..enikk nalla joli thannu anugrahichu. enik ippol joliyil thadasam neridunnu..amme anugrahikkane..ente ippozhulla ee sankadam avidunnu kanane..enikk ee joli nashttappedan idayakkaruthe...amme mathave anugrahikkane... doha 2014-07-02
Claret Pinto Lord Jesus, A big big “Thank you” and “Praises” for your wonderful miracle on my sisters Job with Emirates. My sincere gratitude for all my brothers and sisters who have put in their best in prayers for my sisters job. I pray that her new job with Emirates will be good, helpful, beneficial and love with what she does. I surrender my prayer for my wife, she is shy away (few more weeks) from her delivery of first baby. Lord you send your Angels to protect both the child and mother. Lord Jesus please help my wife to have health, safe, normal pregnancy and Delivery of our Baby. Lord I also pray for my ailing prayer, they are all alone. Help us children to be together with them to be with them, to love them and above all to Care them. Please bless them with best of health, peace, love and happiness. I surrender my Job Lord at your feet. The owners representative and my management top leaders will be at our office from 05th July 2014. Lord please protect me from all the odds. I pray for all souls in purgatory. My prayer for my aunts for their health, peace and happiness India 2014-07-02
SM Please pray for me that RSV has a safe and happy journey till she reaches home and everything goes on well, that Sunny immediately comes here to do the marriage and that Li is happy and co-operative, that I have no problem with the card and get ctomorrow easily and the sale amount reaches me urgently. M 2014-07-02
mahesh Dear amma please bless my family.give good health to vijaya kannarishika amma and nanna.bless prawn pond give them good health and growth.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-07-02
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA… Bangalore 2014-07-02
Joseph Amma, Save us from sins. Give us our daily life happy and joy. You know what we need. Please amma give us our need. Give us good health. Lead us in your way, the love and peace way. amma, engal thaaye, save us. Oman 2014-07-02
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-02
Maria Doss Roche Victor Nandri Madhave, Thanks for this wonderful life, Thanks for blessing every one , Amen Chennai 2014-07-02
subramanian Dear Holy Mother Mary Please forgive my sins and bless me and my mother. My mother has lost both eyes vision due to glaucoma and weakness in central nervous system. She is undergoing Ayurveda treatment. Please bless my mother to restore her vision in both eyes. Thanks. Please bless me to clear all my debts. Vailankanni Matha ten days back, I have given the letter for VRS.  Kindly sanction it and make the settlement as per VRS immediately. You  know mother about my financial position, so please help. Thanks Regards Subramanian kanchipuram 2014-07-02
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted> mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries help us in our job help us get agood increment, good promotion. Mother please bless us sort our family, Mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension., Mother please bless avi n me good health n job satisfaction. mother please bless my family peace n happiness. mumbai 2014-07-02
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing every one in this world, Thanks for blessing my family , Thanks for blessing our business , Amen Chennai 2014-07-02
mm Ma Good Mroning, Amma I thank you from the bottom of my heart and always your servant and a beggar in front of you ma. Thank You Ma thank you ma auh 2014-07-02
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,peace of mind,good health,and protect us from all evils ,dangers and accidents and forgive our sins and forgive those who sin gainst us.My saviour please bless my family with peace of mind,and give my wife with good brains shw always fights with me adn today my daugther is suffering from hungry ,mother mary why she doesnt understand am working here am not enjoyin gmy life ,my saviour show me way for all my problems and please save my job,my naem and my dignity in this company am working in privite firm and everyday its insecure feeling and there is not sablity in my job and i always live underfear ,mother mary today also i haev meetign at 2 pm to 3 pm agin about he AV and IPAD issues,i dotn why od i make mistakes please give one more chance so that i dotn lose my job adn forgive me for my sins and give em peace adn sucess in my life.Mother Mary my saviour come to my aid and give me strenght show me way to coem out these problems and please bles smy hosue with peace of mind adn today am going to delhi for 4 to 5days of leave ,during my absence please save my job and dingity in this company.My saviour dont let me down i need your blessing and pls save me from all my problems and issues and pls give me peace mother mary my saviour come to me and give me life adn help me control my ego,anger and pls mother mary why is my life bad and coem to my aid adn shwo me way for all my problems and issues adn give us our daily bread adn forgive my sins and show me way the job i had attended th interview nothing is ahappening on that ,increment is very low and there is no promotion mother mary this month am comingto your shrine am goign to shave my head ,its left yo you to decided whetehr i should stay inthis compnay or not pls today save me adn my job and give me new job bless my realtionshipw ith my team,my CEO adn my boss adn pls bles sme with good leadership qualities adn frgive my sins. In your name am starting myday pls come to me and be with me with all my meetings and give me confidence and strenght to over come all my problems and gudie me work hard. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved god of man pray for us. Everythreatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-07-02
rupa Thank you dear mother for the favors granted. Keep us blessed always and be with us every moment of our life. Amen! Mah 2014-07-02
Krd Maa please heal my grandson .he is suffering from high fever and in hospital since day before yesterday. His got high fever yesterday night also. Kindly help us maa. Vadiki fever normal ki vachi thondaraga recover ayyetatlu chudandi thalli. Maa prayers lo lopam vunte mammalini kshaminchi maaku sahayam cheyyandi amma. Pune, india 2014-07-02
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. DON'T LEAVE JOBBIN.BLESS HIM TO COME UP IN LIFE. Tiruchanoor,Tirupati rural. 2014-07-02
2014-07-02
kavitha henry Mother Mary pls have mercy on me amma today for my sweet son 3 months start amms pls bless for him and always pray for him amma,amma my daughter's test start from next Monday on 7th amma pls help her and bless her amma and bless my office And I should have more admission compare to last month amma pls help me in my business amma I should have a good business and soon I should solve all my problems amma first I should take all the golds amma from the shop my interest is going up and up amma pls have mercy on me amma always bless me and be with me amma,your every thing to me amms Appa,akka,anna every you only ma so I love you so much amma ,amma pls pray for me that I should be slim and fit I should not put more wait amma pls bless me keep me fit amma always so I want be having any health problem amms so pls be with me amma Amen.... bangalore 2014-07-01
henry mother mary thanks so much for last months admissions. this month we should get more admissions and touch ups. we should always have full classes everyday. this month we are giving baptism to my son. kindly bless him with good health. my daughter should study very well. kindly bless my family with all happiness. kindly bless my parents with good health. amem. ave maria. bangalore 2014-07-01
christy dear madhave, help us to find customers for our new house. pls....pls.... ngl 2014-07-01
Mathew Sajeev Holy Mother, Please pray for good health of my son. Please pray for him to have strength and good health. Please pray for him to start speaking words and understand language. Please pray for him to start speaking for his basic requirements. Please pray for him to start communication. Please pray for him to have understanding to go to play school. Please pray for him to be less naughty and listen to our instructions. Please pray for him to start speaking and communicate. Please pray for good health of my mother who is taking care of my son. Please pray for her to get well soon from gastric problems and body aches. With thanks and prayers Mathew mezhuveli 2014-07-01
Krd Maa please pray for my grand children . One is suffering from fever and other from skin allergy. Vallani thondaraga recover ayyela chudandi thalli. Problems rakunda chudandi amma. Maa Prathi problem lonu help chesavu thalli. Maa theliyani papalu chesivunte kshaminchandi. Love you mother. High fever vasthe Vadiki fever cramps vachevi amma. Sampurna arogyanni prasadinchandi thalli. Allergy Ventane thaggela bless cheyyandi maa. India 2014-07-01
Jeanne Rodrigues Mother Mary I lay my son Luke at your feet.I ask You in your infinite goodness to bless him, heal him & cure him of the nephrotic syndrome that he is suffering from. I know in my heart Mother that You will hear my prayer for You know the pain of seeing your Son suffering on the cross.I will live to praise & worship You forever. Thank You Mother Mary. goa 2014-07-01
Arindam Roy Chowdhury Maa, There is a threat of permanent closure of my company. In that circumstance me and my family along with my children who are getting their education will be in deep trouble. Their dream will be ruined. Please save my family. Ranchi 2014-07-01
rosely ouseph Our Loving Mother Mary lots of thanks to given you and your son Lord Jesus, Ma please pray for my children.Give us good health and wealth, protect us from all evils and enemies.Oh Mary Ma pray for my daughter in law and my son and to get free from their loans. kerala 2014-07-01
Thambi For my self & my family's well being, our health problems, & for my daughter nisha's wedding & also for my estate's financial problems. Madikery 2014-07-01
Freny My dear Mother Mary and Jesus Christ. Thank you for the blessings. Please bless Leonor and Mansour with good health and lots of help. I am very worried about their health. Also bless Sushila and everybody in this world with good health. We love you. Freny and the world. Dubai 2014-07-01
Freny My dear Mother Mary and Jesus Christ. Thank you for the blessings. Please bless Leonor and Mansour with good health and lots of help. I am very worried about their health. Also bless Sushila and everybody in this world with good health. We love you. Freny and the world. Dubai 2014-07-01
r mathave kathu kollane please take care of mummy and aaron.please help them and be with them. mat have, i pray for my exam today.please help me get full marks like last time.kathu kollane mat have.apathonnum varuthathe nokkename amme. sc 2014-07-01
r mathave kathu kollane mathave, please please please be with me . I want to do the remote testing for my exam and am going to see the scpdpeople today.please please please be with me amma.please let them agree to everything.kathu kollane mat have.koode undayirikkename amme. pa 2014-07-01
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-07-01
Krd Maa my grandson had a very big fever cramp yesterday night. Doctors told he will sleep for 4 to 5 hours because of that medicine. He is in the hospital. Maa please bless him to recover fast and make him normal person. They went for a holiday in Greece. Amma vallani kshemanga denmark lo valla intiki cherchandi thalli. Mee chethulu, blessings maa family meeda eppudu vunchandi thalli. Meeku enno kruthagnatha sthutulu chellinchu kuntanu thalli. Maa papalanu kshaminchandi. Love you maa. Intha Kalam Prathi problem lonu maaku help chesavu thalli. Vandanalu. Pune, India 2014-07-01
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-07-01
Deepa Mother,please bless me and my family . I need your support to face every situation. Help me Gurgaon 2014-07-01
Maria Doss Roche Victor Nandri madhavee, Thanks mother , Thanks Mother , Thanks Mother, Amen Chennai 2014-07-01
mm Ma Good Morning! I thank and praise you ma for all your blessings and graces. Ma Please take all my daughters exam papers to the right hands and excell her in all papers please ma. Ma my daughter and her friend should reunite again please take care ma. bless my niece with suitable life partner and bless my sister with good health and keep her husband in yr care and love. Ma bless us both spiritually and materially and good health ma and so with my mother.and all kit and kins. Thanks Ma auh 2014-07-01
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life., Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help usget a good house, good health, good promotion, good house. Mother please bless us sort our family dispute. Mother please bless us get agood full time maid. mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension, Mother please bless avi n me good health n job satisfaction. Mother please bless my dad eternal peace. Mother please bless my family peace n happiness mumbai 2014-07-01
lavi Mother Mary Bless me.Thank you Mother Mary my manager approved my annual leave. Thank u.... uae 2014-07-01
Krd Maa my grandson Arjun's reports have to come and doctor should tell regarding discharge. Please bless him everything will be normal and recover fast. Amma inka eppudu Vadiki fever cramps rakunda deevinchandi. Aurarogyalu kaliginchandi. Vela vela sthotralu meeku. Maaku mee rakshana ka ail thalli. Innallu maakuda vunnanduku meeku sthotralu. Mammalian I vadalakandi thalli. Pune, india 2014-07-01
christy dear amme madhave, situations are not yet changed. i ur daughter has strong beleif in your love and prayers, is expecting you to do miracle in this instance. dear ma give us works asm, titus care of, kesari, valliyur and pullipanam . i beleive in u. help us in this time sir. ngl 2014-07-01
S Mother we thank you for all the blessings that you are showering on us. Ma, we like to come there in velankanni and pray for your blessings in August. Ma, I am in tension about whether I will be able to come or not. Ma, help us to come there and pray. Ma, relieve my tensions and bless us. Ma, I surrender me, my husband and my children before you. Protect us from all dangers and diseases. Bless us with a happy, prosperous, peaceful, healthy and long life. Ma, I am worried about my disease, I have got appointment to consult doctor on 11th. Ma, help the doctor to find it out correctly and cure it ma, and bless me with healthy long life and enable me to do the responsibilities of wife, mother and daughter. Help my husband to solve the issues in his business and make the business a success and continue it. Bless our children with good character. ma, protect our parents and relatives. Ma, bless me, my husband and children with a happy, prosperous, peaceful, healthy and long life. Abu dhabi 2014-07-01
MANIYAN PARAMASIVAM amma. i am sorry for all my bad behaviors amma. i am really sorry for all my bad things i did so far amma. i will be good really. amma. i just want all my wants asked you so far amma. i submitted my wants to you amma . i hope i got all of them amma. i love you amma. be with me and bless me amma. i need you to be with me and bless me always amma. i will be good. i stop doing all my bad things amma. i submitted my wants i hope i got all of them amma. with your blessings maniyan paramasivam. amma. i am sorry again. i will be good amma. i just come to you . i hope i will get all of my wants. if i get all of my wants i will be good amma. i love you. i start doing good. i will continue because you had given me all of my wants . make me perfect and brilliant, very fast in all, and healthy, very lucky very successful. good name from everyone. with your blessings. all the job doing perfectly and in a best way, very good communication skills amma. be with me and bless me amma. surat 2014-06-30
Sarah The Name of the father ,son and the holy spirite, Dear Mother Mary Peace To you. I have some prayer requests from you kindly please assist me. apparently i am facing lot of problems all the place. the main problem i am having finance problem which are can solve it.this happened because of lot of debt & cheated by my husband friend. My mother-in-law is paying more attention to the second daughter law not convert to catholic & no rough & she did not like me & hurt me. I take care of her very well but he is more like the second law of love. I also thought a lot about this .because os she carrying of my both kids, I had to keep my self queit.now i am Now I sit sharing her home, she is often sarcastic with me & my husband. although we have no money, she no we do not think Mood, but he was very sorry for the law. because no money she wont respect me.i have to search for diffrent house.apparently i am having phobia please heal for me please pray for my parayers.for the problem above Malaysia 2014-06-30
Tresa D'souza Please pray for me, i have diabities, high blood pressure and urinary track infection, due to which my creatine level has increased to 5. I have been admitted to HOly Family Hospital on Thu night to the general ward and on this Sunday i was shifted to the ICU. Please pray that the infection may reduce and I may not require dialysis and my overall health also may improve. Hope Jesus hears my prayer. Thank you all, for your prayers. Mumbai 2014-06-30
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2014-06-30
racheal Amma mathaveee, njangale sahayikkanee, amme ellam amma tharunnna anugraham analloo amme financial prblms ellam sheri,akki kodukkanee, ammee orupadu naalayi vishamikkuaaa.. Ammee sahayikkalee kadangalokke theranee.apathukalil ninnellam kaath kollanee. Amme njn thettayittonnum cheyyan idayakalle plz amme Ente veetikarude prashnangalellam sheriyakki koduth njangale anugrahikkanee.. Amme nanniyode aa sannidhiyil oodi varuvan ulla anugraham nalkaneee.. Ammee kaathkollanee pleaseee... munnar 2014-06-30
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. I CAME TO VELANKANNI WHEN I WAS STUDYING IN HINDUSTAN ENGG. AND I WROTE A PRAYER REQUEST TO YOU THAT I WANT TO DO Ph.D IN AERONAUTICAL ENGG. WHAT DO YOU WANT TO SAY ABOUT IT NOW? MY FRIEND TOLD ME THAT WHATEVER WE ASK IN VELANKANNI WILL COME TRUE.TILL THAT TIME I DIN'T KNOW THAT YOU ARE THAT POWERFULL. I DON'T WANT TO LEAVE YOU! Tiruchanoor,Tirupati rural. 2014-06-30
ARCHAN SWETHA MARYMATHA STOTRAM I WANT TO TELL YOU SOMETHING,ONE DAY WHEN I CALLED TO RACHEL AUNTY SHE SAID ME NOT TO LEAVE THE COLLEGE,WHEN I WAS STUDYING IN HINDUSTAN.THE MOMENT SHE SAID,I LEFT THE COLLEGE,EVEN WITHOUT MY PERMISSION.NOW I FEEL,MIGHT BE SHE SAID ABOUT NEW HORIZON.AND EVERYTHING SEEMS PERFECT IF YOU THINK FROM NOW ON.WHAT DO YOU SAY? 2 YEARS AERONAUTICAL ENGG. M.TECH AND I WILL GET JOB AND AFTER THAT MARRIAGE AND AFTER THAT CHILDREN AND IF YOU WANT ME TO DO Ph.D THEN EVEN THAT WILL COME TRUE.MY NEW OWN HOME. MY CAR. MY PROMISES TO YOU. EVERYTHING COMING TRUE. THANK YOU. Tiruchanoor,Tirupati rural. 2014-06-30
catherin I was in love with 1 person for the past 5 yrs,for the 5yrs itself there are so many problems between us eventhough i adjust everything i loved him truely and i croossed the limit even before 1 year we said this to our parents in the meanwhile i got a job his torture increased and he doubted me a lot i cant tolerate his torture and he used very badwords to scold me and i said everything to my mom he and now my parents and me rejected him.im born christian he is hindu.now also he s torturing me.i reaquest you to pray for me to get a relief from this problem and my parents were searching for a groom he should understand me and he should me my best friend pls pray for me AVE MARIA AVE MARIA dindigul 2014-06-30
sampathkumar Respected Father, My father is suffering with gastric problem,due to this condition helpless thought is taking place,physically and mentally he is not well, so please pray for my father to gain sound of health & peace,and eternal blessings from Mother Marry. My Father name is : Talamala Prabhakar Rao. thanking you, your's faith fully, sampath. Hyderabad 2014-06-30
sangeetha my dear mother,i have face many problems but all problems are solved you amma.i have mentally stressed for the reason son was two times fell down the floor,blood will comes the lips and go to the doctor.but i have fear now. i cannot do any work.Please cure the wond,he eat normally and please give good health for your child.matha amma you are my life.you always live with me.Please give good health for your family.I request to pray for us.my mother is arokya annai velankanni matha. coimbatore 2014-06-30
p Velankanni mata, more kaam somballo ven keri soduvo mogo uncha kaam thevo mogo jhukku easy kaam thevo mogo more kaam chokkad cever podno me more kaam senam easykan musadno. Bless me velankanni mata. Amen v 2014-06-30
maria raj dear mother , every request i put at your feet you answer and show me mercy and miracle..thank you for helping my husb realise my value and trying to unite us..am still awaiting for a day when we both will live in a house and have blessing kid in our life...mother as we are planning for this am currently encounterd with huge professional problem.. one of my collegue is trying to snatch away my work..please help me mother and see that my job is safe with me with no risk have mercy on me and protect my job..am completely depressed and unable to concentrate on my personal life to plan for kid...am sorry incase i have sinned against anyone collegues, frnds, family etc...forgive and wash my sins and protect my job and guide me to a truthful life..please help srini realise that he should not statch my job and that higher people support me and give me justice in my job and that my job is with me and safe...i beg you mother have mercy on this sinner of urs.awaiting for a miracle in my life at this critical situation of my life..am down with both professional and personal life...everything is gone out no peace and happiness mother..have mercy and do justice to me. hyd 2014-06-30
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-30
Baby Velankanni Mathave, I am with thankful heart , for providing all documents in time.Please bless my son. Please be with us every moment. Kindly make things smooth.Please intercede for us in prayers to Jesus Christ. Kindly bless us with health,peace and happiness. Kindly bless Raju and family. Amen. KOTTAYAM 2014-06-30
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANAKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. Tiruchanoor,Tirupati rural. 2014-06-30
ARCHAN SWETHA MARYMATHA STOTRAM PGCET-2014 APPLICATION FORM IS RELEASED.PLEASE HELP ME IN FILLING THE APPLICATION FORM SUCCESSFULLY.PLEASE MOTHER MARY.................. Tiruchanoor,Tirupati rural. 2014-06-30
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-06-30
2014-06-30
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone , Thanks for blessing my family , Nandri madhavee, Amen Chennai 2014-06-30
Sheeba Amma,I have some problem in Utrus and harmon problem.Please Amma Cure it.Amma.... Kuwait 2014-06-30
jennifer dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get a good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless us get agood full time maid. mumbai 2014-06-30
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,peace of mind and protect us from all evils,dangers and accidents and sae my family whoa er alone from all evils,dangers and protect them give them good sleep ,peace of mind adn strenght to withstand that loniness.Mother Mary i haev three things which i need your blessing ,IPAD confusion which will result in me losingmy job and spoilingmy reputation inthis company second things there are no new offers coming one itneview i attended but there so response,mother mary my wife's jewels and legal case,my saviour these my problems which are palceda tyoru feet i kneel and plead you to bless me so that i dont get into any such issues where my CEO and my Boss fidn sme useless and throw me out this company,mys aviour please coem to my aid and show me way for my problems and mental tension am goign thro and mother mary from tommorrow onwards we haev AV audit with another person from the VHO ,i need your bless ing and guidence so that everythign goes well withotu any problems and issues adn mother mary please save me and shwo me way and ome to my aid ,my job and my name adn dignity inthis company will go if i dont prove my self,where will i go if i lose this job and what will i do i haev committmetns i'llbe fallen in front of everyone my family will be on roads and mother mary i promise i 'll coem to your shrine and sahve my head adn kneel and coem to your holy tank this is my promise adn i'll fulfill allthe pending offerign which ihave committed.Please dont punish me and one more thing mother mary please forgive me for being rude and hurtign others feelign adn making them feel and i o behalf of my parents and all those peole who had helped us in one or the othe way i ask them to forgive me adn bless me with sucess adn forgive my parents also,they what parentsdo are repented by there kids,please show me i fall at eveyone feet who all have goen mental tension and who all have been hurt my words and action in my daily life adn by my partents i ask them in lord naem to forgive and shwo em and bless me so that i and my family are happy .Please mother mary i beg to forgive for my sins adn bad action,pls celan my body and solu and my thoughts sot aht i becoem godo displie of the lrad jesus thro you.Bless this week with sucess and prosperity adn protect me from all dangers ,humilation ,insults and give me confidence and strenght to ovr come all problems iss isuess adn guide me to take right desions so that everyyone lieks me as person. Mother Mary my sufferign from mental illnes adn there is no peace and ther is always insecure feeling in me adn i lack in confidence so please shwo em way for all my worries adn life me and forgive me help me to celar all my loans and lead a decent adn happy life with my family and friends.Bless all my IT infrastreucture adn my team members so that wea ll worka s team and bless em to be good leader adn work hard.Pls forgive em for taking money and lednign my hand ,mother mary after all these problems are rsolved i'll neve lend my hand in future its my promise. Plsa save my job and name adn pls help me to get godo offer so that i stay with my wife adn kid. IN yoru name am startign my day adn this week plese show me way adn pls give me epace of mind and sucess in all my work i do. O Mary,virgin before childbirth keep me pure in soul and body, O Mar,virgin before chilbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, Everythreatening dangers vanishes at thy prayer. St.Anthony beloved of god and man pray for us. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-06-30
mm Good Morning Ma, Ma i thank and praise you for all your blessings and graces you have showered on me and on my family and on my kit and kin. Ma now i humbly and urgently ask you to please please hear my request as a beggar. Please take all my daughters papers to the right hands and excell in all her papers as u did in Canna of Galilee and help us to win the financila luck and bring a good tenants for us. Thanks Ma auh 2014-06-30
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-30
r mathave kathu kollane, koode undayirikkename.apathonnum varuthathe nokkename amme.amme i pray for my compiler project amma.please let msabouri accept my terms and pray that i do well in that subject as well as 154.kathu kollane amme.apathonnum varuthathe nokkeanme amme. sc 2014-06-30
stephen c Dear People of God, Please pray to Jesus and Mother Mai, to bless all my work for this week with no interference from any other dept.Also thank you Jesus for the successful and safe tour. Praise you Jesus Love you Jesus.Servant of Jesus-stephen Mumbai 2014-06-30
G V AMME THAYE VAIANKANNI MATHAVE PLEASE HAVE MERCY ON ME AND MY FAMILY MAA WE ALL FAMILY THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS AND HELP US MORE THIS MONTH THAN LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND WORKS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITION MAA PLEASE HELP IS IN BUYING THIS HOUSE AS ITS OUR DREAM AND HELP US IN GETTING ALL THE FINANCIAL NEEDS FOR THIS IMMD BY DOING A MIRACLE IN JESUS MIGHTY NAME I PRAY AMEN Hyderabad 2014-06-30
Philip URGENT PRAYER REQUEST FOR Philip This prayer request is for PHILIP. Philip is sick with double vision sicknesses in his both eyes. Philip is going to have his complete both eyes check up for the eyes abnormalities on July 1st Tuesday. Please pray that Philip's complete eyes check up test results for eye diseases will become completly NORMAL and please pray for the healing of Philip's double vision sicknesses in his both eyes by your Prayer only. usa 2014-06-30
Philip URGENT PRAYER REQUEST FOR Philip This prayer request is for PHILIP. Philip is sick with double vision sicknesses in his both eyes. Philip is going to have his complete both eyes check up for the eyes abnormalities on July 1st Tuesday. Please pray that Philip's complete eyes check up test results for eye diseases will become completly NORMAL and please pray for the healing of Philip's double vision sicknesses in his both eyes by your Prayer only. usa 2014-06-30
Philip URGENT PRAYER REQUEST FOR Philip This prayer request is for PHILIP. Philip is sick with double vision sicknesses in his both eyes. Philip is going to have his complete both eyes check up for the eyes abnormalities on July 1st Tuesday. Please pray that Philip's complete eyes check up test results for eye diseases will become completly NORMAL and please pray for the healing of Philip's double vision sicknesses in his both eyes by your Prayer only. usa 2014-06-30
PHILIP URGENT PRAYER REQUEST FOR Philip This prayer request is for PHILIP. Philip is sick with double vision sicknesses in his both eyes. Philip is going to have his complete both eyes check up for the eyes abnormalities on July 1st Tuesday. Please pray that Philip's complete eyes check up test results for eye diseases will become completly NORMAL and please pray for the healing of Philip's double vision sicknesses in his both eyes by your Prayer only. usa 2014-06-29
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2014-06-29
2014-06-29
aruna Amma ma amma suseela gonthu noppitho chala bhadhapaduthundhi,plz amma ameku manchi arogyam evvamma.nakantu unnadhi amma mathrame,nanna(daniel)athmaku shanthi chekuralani ninnu vedukontunna.na thappulu anni kshaminchu amma.nannanu yenthagano bhadhapettamu ayana chanipoyake ayana viluva yento thelisindhi.plz ammaa ammaku unna anni problems poyela chei amma.amma chala bhadhallo undhi avanni thirchamma.vijaya ku manchi sambhandhalu vachi pelli jarigela chudamma,mary arogyam kuda bhagoledhamma.ameku unna back painnu thaginchamm. kurnool 2014-06-29
sridhar "O Virgin Mary, My Mother, I give to Your Immaculate Heart my body and my soul, my thoughts and my actions. I want to be just what You want me to be, and do just what You want me to do. I am not afraid because You are always with me. Help me to love Your Son, Jesus, with all my heart and above all things. Take my hand in yours, so I can always be with You." bangalore 2014-06-29
r kathu kollane mathave.koode undayirikkename mathave.thank you so much mathave for helping me with taproot.please help me with compiler design as well.Thank you for your grace and loving kindness. sc 2014-06-29
Cecilia Oh Mother Bless your son Aaron on his Birthday, keep him in good health of body and mind. Take care of your sons Krish and Yves. Abu Dhabi 2014-06-29
Jasmine Amma, I asked your help about my mom's health. She had a tumour in her body. I asked for the help of you amma. Tomorrow she is going to have a surgery amma. Whatever the doctors can't heal can be healed and cured by your will amma. Mathave pls help my mom to recover from her illness and sufferings. Let her realise your presence in her life amma. We believe in you amma. Everything will be cured in your will amma. Let the surgery be successful and let her not repeat even the symptoms of this sickness in her life amma. I ask you this in the wonderful name of your son Jesus Christ. KWT 2014-06-29
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-29
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN. MATHAVE PLEASE HELP ME IN BUYING THIS HOUSE AT ANY COST WHICH IS OUR DREAM COME TRUE. Hyderabad 2014-06-29
Maria Doss Roche Victor Thanks Mother Mary , For recommending our prayers to God , Thanks Madhavee for taking care of us all the time , Thanks for forgiving all our sin's, Thanks for holding hands through our life, Thanks for taking care of all our need's Amen Chennai 2014-06-29
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. mother please free avi n me of all worries n tension. mother please bless avi n me good health n job satisfaction. Mother please bless us a good full time maid. Mother please bless my family peace n happiness mumbai 2014-06-29
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. mother please free avi n me of all worries n tension. mother please bless avi n me good health n job satisfaction. Mother please bless us a good full time maid. Mother please bless my family peace n happiness mumbai 2014-06-29
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-29
rmg Dear Mother Why are all this thing happening to my family?Mother as you can see all the problems which i am facing.Why is my sister acting in such a bad manner till it hurts my aging mother and the rest in the family.Ever since they bring this girl in the family the problem started.Pls help them to send this girl back.We were once a happy family.Now there is no happines or laughter in the house cos of my 3 sisters.Pls help them to realize wht they are doing n repend.This ia affecting me alot Pls help my daughter who will sit for her major exam in Sept and she has her trial exam in July pls help that she does well mother.I am so worried of her. Pls help me with my sales for July.I am in sales dept and my sales has not been good since Jan of this year.Pls help me. My husband is unhappy with the staff in his office as they humilate him n he is trying to get a transfer which the manager refuse to give.Pls help him with this, Thank you mother for all that you have done for me. Malaya 2014-06-29
lavi Mother Mary Pray for me Amen uae 2014-06-29
mm Ma Good Morning Ma how are you ma, Ma i humbly and urgently ask you to please please take all my daughter papers to the right hands and excell in all her papers. Thanks Ma. Love you Ma. auh 2014-06-29
carol Dear mother, I ask of you in faith to please bless my son and help him with good scores in his exam that has just gone by. please help him to get a job at the Harbour Marriott as a bakery chef manager.please help us with good health.We trust in you dear mother. mumbai 2014-06-29
Jason Thomas Amma thank you for all thje prayers. We are far more relaxed these days with your loving grace. Show us the way to lead a peaceful life. There are a few more financial problems please pray for us and show us a way to come out of it. Coonoor 2014-06-29
christy madhave, help us amme. we are in deep well i feel. no work, new house not moving. our family including children are in bad mood. dear ma, ask ur son to do favours. we our family together beg you to change our life so that we get works to become busy. our offices are not working now. till now we haven't come acroo such a situation. dear ma not for me for ur son jk, pls pray to ur son. surely he will obey you. we will be in a sympathetic condition otherwise. we have no other income. we don't know any other job. our car is also sold. we have to buy one by august. dear ma help us to change all these. we bow on yuor feet. jk had started this business after coming to ur feet and surrendering himself. with your blessing he had started all these u too know. dear ma open ur eyes om us. help us to escape from current sutuation. we all together beg you. we will come to you to thank when the new house selling is over. nagercoil 2014-06-29
christy madhave, our old customers are moving from us. new works are coming but not fixing. dear ma i don't know where the wrong things are hiding. dear ma help us to find new customers. dear ma help us to withstand old customers. dear ma help us to gain good name and to retain the name foreever. protect us from evil and evil people. dear ma protect all of us especially jk from desp and bad mood. ngl 2014-06-29
sheeba Amma,Please amma give me to good health.I have planed to go to hospital for me.Please Amma,cure me before going to the hospital.You can do all.Please amma... help me...I feel very sad.I am not interesting to concentrate in my regular activities because my physical problem, and my husband,and his parents.So please help me Amma.. Kuwait 2014-06-28
r kathu kollane mathave.koode undayirikkename mathave. i pray for my c prjct mathave. i pray that you help me find the right freelancer amma. please help me amma and be with me amma.i surrender everything in your hands amma. sc 2014-06-28
Anish Thomas Mother, We pray for all the thanks giving, all the blessing in our life..what we wished and prayed was given to us.. Today I pray to submit a request at my workplace to make the project go smoothly and any issue Give me the wisdom and courage to over come the same, pray for all my colleagues who is working with me... Make the work place the best place for friendship and caring. Be with me through these testing times Thank you all the blessing My uttermost wish is to come to Velankanni church this oct, please clear all way for this Mumbai 2014-06-28
Maria Doss Roche Victor Thanks mother , Thanks for this wonderful life , Amen Chennai 2014-06-28
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-06-28
Sheeba Amma,now I am going to hospital.Please come with me.I feel very sad.Please amma help me and give good health.I want peaceful news from the doctor.Please amma.... Kuwait 2014-06-28
narayanasamy SAVE MY DAUGHTER J N UMADEVI FROM HER FAMILY PROBLEMS AND HELP HER TO LEAD A NORMAL LIFE chennai 2014-06-28
Thevaapriyaa Amma,please bless me maa.Amma last month I sit for my degree 1 exams maa.Amma total I have five subjects maa, which are Business and Financial Environment (BFE),Management Accounting and Ethics in Organizations (MAEO),Introduction to Financial Accounting (IFA),Quantitative Analysis and Systems (QAS) and Personal and Professional Development 1(PPD 1).Amma for two subjects BFE and MAEO the results was release yesterday maa but today only i got to know.Amma some of my friends have problems in results maa.Amma please bless me to get good results maa.Amma please bless me to get good marks in this five subjects so that I can join degree 2 without any problem maa.Amma please bless me to get a good results maa.Please bless me and be with me maa.AMEN... Malaysia 2014-06-28
kavitha henry Mother Mary pls have mercy on us amma pls help me that I should not put on weight amma I should be fit and slim amma pls bless me as and pray for me amma I have a health problem like the thyroid and period problem amma pls have mercy on me and help me to keep me fit amma this is my special request amma love me and bless me amma,and pls help me in the business and I should have more business amma and soon I should solve all my problems soon before my aunty come from London I should take back the golds from the shop and my interest more amma day by day amma I am not able to pay the interest amma do me some thing and help me amma than my daughter should come up in her life nicely amma and she gave to study nicely amma pls help me amma my daughter first term exam is there amma on 7th July to 11th July pls bless her amma she have to do her exam nicely amma pls pray for her and bless her amma and be with her amma when she writes the test pls amma and bless my son soon he have to do every thing fast fast amma and he should be very smart amma even he should study like my daughter only amma pls amma always bless my family amma what and all I have written its all my request amma pls have mercy on me amma amen. bangalore 2014-06-28
Antony JM "OUR LADY OF GOOD HEALTH PRAY FOR US". Ma here I submit thank giving to you ma for hearing my prayer and showing miracle on my elder daughter stomach pain, last week we done all test and everything was normal, now by medicine she must become normal, thank you ma for showing mercy on her. Once again thank you ma. Tvc 2014-06-28
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US." Ma requesting for prayer to buy house. Ma we are planning to buy house of my wife friend, help us ma everything go well, to get loan to buy the house, show your miracle on us ma to buy this house. Thank you ma. TVC 2014-06-28
Thevaapriyaa Amma please bless Brazil team to win the match against Chile in FIFA Worldcup maa.Please bless them to win maa.AMEN... Malaysia 2014-06-28
Thevaapriyaa Thank You amma.Thank You amma.Thank You amma.Thank You for blessing Brazil to won the match amma.Please keep blessing Brazil ma.Thank You.I love you amma.AMEN... Malaysia 2014-06-28
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN. MATHAVE PLEASE HELP ME IN BUYING THIS HOUSE AT ANY COST WHICH IS OUR DREAM COME TRUE. Hyderabad 2014-06-28
Swapna Amma, please protect me from the evils that have resulted in my bad health. Amma, seek your blessings and everlasting protection. Singapore 2014-06-28
mm Good Morning Ma, Ma I thank and praise you for all your blessings and graces you have showered in my life. Ma, I urgently and with great confident i put my trust in you that you will surely bring good result ma for my daughter you all her papers to the right hands as you did in Canna of Galalee. I know you can make wonders Ma. Thanks Ma auh 2014-06-28
mm Good Morning Ma, Ma I thank and praise you for all your blessings and graces you have showered in my life. Ma, I urgently and with great confident i put my trust in you that you will surely bring good result ma for my daughter you all her papers to the right hands as you did in Canna of Galalee. I know you can make wonders Ma. Thanks Ma auh 2014-06-28
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. Tiruchanoor,Tirupati rural. 2014-06-28
mahesh Dear amm please bless my family.give good health to vijaya kanna amm rishika and nanna.bless prawn pond give them good health.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-28
kavitha Mother mary, wat did I do wrong? Im I after the money? I just helped my parents&my husband is fully trusting others & leaving me apart.i didn't do wrong& people are bitching about my character that I'm money minded.im not doing anything with the money.i dont want any money I just need my husband love which I don't have any trust but only trust is that u will show him the truth... I'm becoming mad in this country alone plz help me amma... I beg u maaa... love uuu... Australia, sydney 2014-06-28
ROHIT oh holly mother, I don't know what have u written in my and family desting but beleive that everthing will be okay with us and you'll solve all the problems that me and family is suffering. Mother u always help your childrens and is always with everyone. please bless us and remove form the problem n tnesion we are facing. mumbai 2014-06-28
ritu. malvia Dear Mother, I don't know y my sister is facing so many problem.Please mother remove all the ostacles from here life and give here good health and peace. Mother please let here get marreied she is 37 and not getting any proposal for the marriage and she is in sorrow. We all are worry about here mother. I know mother u couldn't see any of your childrens in sorrow. That's the reason mother I beg in front of you for here. Mother let everything be okay with here. mumbai 2014-06-28
kavitha henry Mother Mary pls have mercy on us ammaamma bless for the good job and all the problems should solve soon amma with your blessing I should get nice job in Nov amma I want holiday in Saturday's amma pls have mercy amma I should get a good company with good salary amma I should get by near place amma pls bless me amma I should get a job without any certificate amma Pls help me in this amma I have very small baby 1and half month baby amma so I want to go from 7 months amma for the new job with your blessing amma I have lot of credit problems amma I do no what will I happen amma you no that much money problem I have amma lot of credit problems amma pls pls I beg you to solve all my credit and money problems soon amma pls Improve my business soon amma give us Good admission amma every month pls amma I beg you amma to solve all my credit amma amen. bangalore 2014-06-27
Maria Doss Roche Victor THANKS MOTHER , THANKS FOR BESTOWING THE COURAGE INTO ME , THANKS FOR GIVING ME THE HOLY SPIRIT, THANKS FOR RECOMMENDING US AND FREE OUR SINS ALL THE TIME , AMEN Chennai 2014-06-27
Sweety muma I love you mumma for all the favours you have granted to me and on my family i thank you in abundance for the special favour that you have bestowed upon me and my family mumma i owe it all to you your prayers have worked wonders to me all my life mumma thanks for all the blessings care and protection ma i pray to you today to grant me the wisdom to take correct steps in life and that negativity may stay away from me and my family so that i can always be safe and positive and believe in the power of prayers mumma please continue to pray for me so that i may sustain the graces and favours received from the Lord God almighty. Mumma be with me always help and protect always keep this blessings with me and that there may be no hindrances of any kind and that all the plans and things go in a positive and smooth direction. Bless us mumma so that we may be true and dedicated in everything that lye's ahead mumma help me to trust the will of God and guide to to trust in God now and always and all that is going to happen in my life next mumma i just leave everything upon you and your care please pray for us and protect us from all evil now and forever Pray for my Mom and Dad so that they may be blessed with good health and wisdom to take good decisions in life mumma keep them away form all harm and danger always keep all the enemies and evil eyes away from them and form all of us to Mumma i submit my mom dad, my sis n jijs, baby Rose and my self and l to your care and protection keep us in your motherly care and protect us from all harm and danger. be with us always maaa I love you and thanks for being my maaaaaaa India 2014-06-27
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2014-06-27
Shaline Mary Dear Mother, i humbly request this prayers for myself...mother I'm pregnant 29 weeks now, I pray that my cyst at my right hand will go off without any problem for my health and also give me a healthy life.. Now I can feel one more cyst is coming at my right armpit.. I'm really worried.. I pray that all will gone with your miracle touch.. I trust u Mother.. Please help me, have mercy on me.. .. Malaysia 2014-06-27
Sheeba Amma,I feel very sad because of my physical problem.Please give good news from the doctor. And give peaceful mind.Amma ...Amma.. Kuwait 2014-06-27
Midhu I Mrs.Midhu living in canada.I wotr two canadian nursing council exams to get the registration to get a job.But the first exam results came and i failed for 13 marks.I am very sad and depressed.Cried a lot.My another exam results not yet published.Within 2 or 3 weeks the results will be announced.It was tough exam.I have to score 550/800 to get a pass results.So please pray for me to get a pass results from the College of nurses Ontario.... CANADA 2014-06-27
Midhu I Mrs.Midhu living in canada.I wrote two canadian nursing council exams to get the registration to get a job.But the first exam results came and i failed for 13 marks.I am very sad and depressed.Cried a lot.My another exam results not yet published.Within 2 or 3 weeks the results will be announced.It was tough exam.I have to score 550/800 to get a pass results.So please pray for me to get a pass results from the College of nurses Ontario.... CANADA 2014-06-27
Bala Kanishka Please pray for me and Tapaswini that our beloved God may forgive each and every sin we committed and may He bless us in marriage by removing every obstacle. I ask this in Jesus name. Amen. Hyderabad 2014-06-27
kavitha henry Mother Mary pls have mercy on me amma bless me for the money to take my golds amma when I ask the money to Shanmugam sir he should not tell no amma pls have mercy amma bless me amma with your loving I should take all my aunty's gold first amma and I should give back to her amma if I plug my gold's there is no problem amma Amma if I ask to sir what will he think amma when I ask to him pls you should be with him and with me amms pls have mercy on me amma pls arrange me for the money amma pls pls I beg you amma love me amma Pls pls help in this amma so many things you have given me amma pls amma help me in this amma,because of me pray with Jesus Christ to solve all my problems soon and take back all my golds soon amma pls have mercy on me amma help me in this thing amma only your there for me amma pls pls this is the word of the lord thank sweet to god amma amen. bangalore 2014-06-27
Rupa Thank you dear mother for granting me the favor regarding my mother's report which has come normal. But, oh mother, she is still having some pain deep inside. Please bless that this pain should also go and nothing should be wrong with her in anyway. I once again thank you oh mother, for helping me and being with me whenever I have come to thee. Keep us blessed always. Mah 2014-06-27
rupa Dear Mother, I have one more thing to ask of you. I have a lump kind of thing in my right armpit and I am very scared to visit a gynaec. Please help me, show me your miracle and let this lump just vanish away. It should not be anything serious oh mother. You have always helped me whenever I called out to you. Please help and bless me with good health without any sickness or disease. Mother, show me the right way. Please help me oh mother...I believe in you. Mah 2014-06-27
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensns and stress i I'm being now, mother as I am suffering from severe wheezing , mother I am unable to breathe mother , I am totally sleepless and restless mother, mother please heal me mother , touch me and heal me now mother, I beg you to please heal me now mother , mother have mercy and heal me moth, mother do miracle now and heal me mother, heal me totally and bless me with good health peace and happiness forever, mother please come into my life now hold me heal me change me and strengthen me mother, mother please come to me now mother please help me mother, mother always be with us mother ,mother as you know since 7 years I am living far of my parents and home , due to my marriage issue my dad left me and restricted my mom and all my family not to keep contacts with me , mother please gave mercy and please soften my dad heart now and let him forgive me and accept me my husband and my child now and allow my mom and all my family to keep contacts with me and allow me to home, mother please hear my cry mother and grant all my prayers now mother, please answer to my prayers now mother,and please reunite us with my parents and home now and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mither amen. bangalore 2014-06-27
S Dear beloved mother Mary, mother please help me, mother please save me from all the tensns and stress i I'm being now, mother as I am suffering from severe wheezing , mother I am unable to breathe mother , I am totally sleepless and restless mother, mother please heal me mother , touch me and heal me now mother, I beg you to please heal me now mother , mother have mercy and heal me moth, mother do miracle now and heal me mother, heal me totally and bless me with good health peace and happiness forever, mother please come into my life now hold me heal me change me and strengthen me mother, mother please come to me now mother please help me mother, mother always be with us mother ,mother as you know since 7 years I am living far of my parents and home , due to my marriage issue my dad left me and restricted my mom and all my family not to keep contacts with me , mother please gave mercy and please soften my dad heart now and let him forgive me and accept me my husband and my child now and allow my mom and all my family to keep contacts with me and allow me to home, mother please hear my cry mother and grant all my prayers now mother, please answer to my prayers now mother,and please reunite us with my parents and home now and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mither amen. bangalore 2014-06-27
2014-06-27
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-27
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. MY AMBITION OF BECOMING AERONAUTICAL ENGG. IS FROM 8th STANDARD. ONE VISIT TO VELANKANNI. Tiruchanoor,Tirupati rural. 2014-06-27
Maria Doss Roche Victor Nandri Mother mary , Thanks for this wonderful life, Nandri Madhavee, Thanks for being with us all the time . Amen Chennai 2014-06-27
2014-06-27
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-27
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-27
Deenadayalan Dear mother Mary, Forgive me for my sinful thoughts. Please make Kirthika understand my feelings for her, I cant live without her. Bless the life and love I am longing for. Please make my prayers come true. I want to come to Velakanni soon with the happy moments. Love you mother. Chennai 2014-06-27
LJ Dear amma...i don't know from where or how I got this disease. Please cure me of this disease. I'm tired of living with it :( What wrong did I do to deserve this? Please cure me amma...no more than ever...I don't want to give it to my wife and child. Please cure me....please...hear my prayer amma....please amma...please...please...i love u.....take care of me and my family....thank you for all you gave me so far. Thank you. Blore 2014-06-27
lavi Mother Velankanni Pray for me my personal request. uae 2014-06-27
christy amme madhave, situations are not yet favourable. todaya too i went to new house. a beautiful house. but dear ma people are not coming till the end. dear ma help us to do document of it in a short period. we are affected mentally and physically i think. jk is much desperate on the thing happing. dear ma help us to overcome the problems and financial crises. we need to buy a car, we need to documet the new house and we need to improve our work environment. thanks a lot for giving us a peaceful family life, good health, brilliant children, nice house etc. etc.... dear ma pray for us to your loving son who can give us all whatever we want. nagercoil 2014-06-26
V & P I BEG YOUR INTERVENTION, I am trying for a promotion in the same organization with salary hike or a new higher level job with appropriate salary increase. My current job involves 5 hours of daily travel. It is very difficult for me. Matha, i beg your blessings save me from this difficulties. Our kids are suffering from various diseases and difficulties in learning. Our partition is pending for years. Our money is blocked in Insurance. My brother's income source is in crisis. My brothers son is facing problem for his admission. My mother is having knee pain and other problems. Provide good health for my wife, kids, amma and me help us in overcoming all these issues Kottayam 2014-06-26
Kiran Dear Mother Mary, please pray for us... that there will be peace in my family and in my office and give me a good health. My wife have health problems like B.P. & also having cold & sneezing regularly in Bangalore weather from last 11 years and also she is taking more tension. Please pray for us for a normal & healthy life.please bless my parents with good health. my daughter and son should study very well and should be very active. we should live very happily with your blessings. Bangalore 2014-06-26
Kiran Dear Mother Mary, please amcha khathir mag. Maka garanth mothik samadan na, moja and moja pathine bither sama kattu woolovne na. moja pathin ani moja papa, mummy bhither misunderstanding jala, nthe sama jhanwcha bari kar. moja pathinek bori bhalayki ani mothik samadan di. Maka bori bhalayki ani amcha burgank bori bhalayki, samjani, bori bood and schoolanth shikonku bori ginyan di. Amche sarve kasht poys kar. Moja kamanth shanthi samadan di. Kamanth kaloy problem jaynashe rak ani sambal. Moja bossan head office thawn diwnchi salary 6 month thawn pending asa, ani thi salary maka veggin melcha bari kar maye. Moja papa ani mummyki bari bhalyki di. Amche sarve reen veggin pari kar maye ani mukar amka bore dees yewncha bari kar. Mary maye ye magne thuja panyathalar dovrith, please amcha khathir mag. Bangalore 2014-06-26
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health.give me job amma.thankyou amma. varahapatnam 2014-06-26
Stella Dearest Mary, My mom is suffering from cancer and dr give us within 3 - 6 months. We don't know what do? And her wish to visit you from Canada. Mary Please help her and also youngest daughter not settle her family life too. Please we need your support Mary................ Thank you Ajax, Ontario 2014-06-26
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones Amen. --- 2014-06-26
Phani Bhaskar I am appearing for UGC NET 2014 and want to be qualified.I am also eagerly looking forward for a job that pays me INR 12 L per annum as per my skillset. I am still bachelor at 35 years and want to get married to good girl from my religion soon. I wish 'Lady of Good Health blesses me.....I am praying and also seeking your help to pray on behalf of me at the shrine altar. Amen. Hyderabad 2014-06-26
Seema kandukuri Dear god, please help me get settled with Subbu immediately . I love him lots and want to be with him all the time Pune 2014-06-26
r kathu kollane mathave.koode undayirikkename mathave. father lord, lord jesus, holy spirit,st antony appacha, st jude appacha, appe, kaval malakhamare, kathu kollane when i ask for the optimization project to replace the exam. sc 2014-06-26
Anie Shaji Dear Mother, Please i request you to pray for my small family which consist of my husband (Shaji Mathew), daughters (Sneha and Shreya) and myself as we undergo many mental agonies and problems in our life which is the after effect of young days where there was financial problems, sickness which led us to take certain decisions which unknowingly hurt-ed others happiness which is now creating curse, anger among brother-brother relationship as well as mother-son relationship. Please pray for my family so that we are not shattered by the words of mere human being rather humble our-self and pray to Jesus and our Lady for her help and blessing to lead a blessed family life as per her will. I submit my family unto her arms to keep us safe and secure under her care away from the worldly curse and anger. Please Pray for us and save us with your prayers. With prayers. Anie RAJKOT 2014-06-26
S Dear beloved mother Mary , mother please help me, mother please save me from all the tensions and stress I am bearing now, mother please help me,mother as I am not feeling well I am suffering from severe wheezing , mother I am unable to breathe mother , became very weak mother have no strength to do any work mother and Bo have a small child to take care of , mother please heal me mother touch me and heal me now mother, mother please have mercy and heal me moter, mother do miracle and heal me mother,heal me totally what ever bothering me mother, mother and bless me with good health peace and happiness forever , mother please come to me now mother hold me heal me change me and strengthen me mother ,mother please hear my cry now mother and please answer to my prayers now mother, mother as u know due to my marriage issue my dad left me totally and restricted my Mom and all my family not to keep contacts with me, sinfeb7years i am living far od my parents and home ,mother plplease forgive me and let my dad forgive me and accept me my husband and my child now and allow my Mom and all my family with my parents and home,mother with out my dad's acceptance I have no place in my parents home , mother please help me I beg you mother please help your child now and reunite us with my parents and home now,mother I beg you to please hear my prayers and grant my prayers now , and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen bangalore 2014-06-26
S Dear beloved mother Mary , mother please help me, mother please save me from all the tensions and stress I am bearing now, mother please help me,mother as I am not feeling well I am suffering from severe wheezing , mother I am unable to breathe mother , became very weak mother have no strength to do any work mother and Bo have a small child to take care of , mother please heal me mother touch me and heal me now mother, mother please have mercy and heal me moter, mother do miracle and heal me mother,heal me totally what ever bothering me mother, mother and bless me with good health peace and happiness forever , mother please come to me now mother hold me heal me change me and strengthen me mother ,mother please hear my cry now mother and please answer to my prayers now mother, mother as u know due to my marriage issue my dad left me totally and restricted my Mom and all my family not to keep contacts with me, since 7years i am living far od my parents and home ,mother plplease forgive me and let my dad forgive me and accept me my husband and my child now and allow my Mom and all my family with my parents and home,mother with out my dad's acceptance I have no place in my parents home , mother please help me I beg you mother please help your child now and reunite us with my parents and home now,mother I beg you to please hear my prayers and grant my prayers now , and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen bangalore 2014-06-26
mahesh Dear amma please bless my family.give good health to vijaya kanna amma rishika and nanna.bless prawn pond give them good health and growth.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-26
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……. Bangalore 2014-06-26
mini furtel arogya thaye amma,i submit a prayer infront you my father facing very dangerous unhealthy problems. His docter make tests and sent biospy,and he says it may be cancer. Amma please help us this situvations and pray for us, remove the complicated growth in the stomech. We wants to visit you with our healthy father.Amma don't refuse our prayer and give good answer without anydelay.Thankyou amma kerala 2014-06-26
mini furtel arogya thaye amma,i submit a prayer infront you my father facing very dangerous unhealthy problems. His docter make tests and sent biospy,and he says it may be cancer. Amma please help us this situvations and pray for us, remove the complicated growth in the stomech. We wants to visit you with our healthy father.Amma don't refuse our prayer and give good answer without anydelay.Thankyou amma kerala 2014-06-26
mini furtel arogya thaye amma,i submit a prayer infront you my father facing very dangerous unhealthy problems. His docter make tests and sent biospy,and he says it may be cancer. Amma please help us this situvations and pray for us, remove the complicated growth in the stomech. We wants to visit you with our healthy father.Amma don't refuse our prayer and give good answer without anydelay.Thankyou amma kerala 2014-06-26
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-26
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Motherpleaes bless my son good health, make him peaceful and normal child. Mother pleaes bless avi n me good health, make us peaceful, free us of all worries help us in our job, help us get agood house, good increment. Mother please bless us sort our family dispute. Mother please bless us get a good full time maid. Mother please bless bless my dad of eternal peae. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-06-26
Maria Doss Roche Victor Nandri Madhavee, Thanks for giving us this wonderful life , Thanks for blessing every one in this world , Thanks for bestowing us with the holy spirit , Thanks for blessing my Family , Colleagues & Friends , Amen Chennai 2014-06-26
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. 1.IF,YOU GIVE ME A HOUSE,I WILL GIVE MODEL OF THAT HOUSE TO YOU,VELANKANNI. 2.I WILL GIVE THE NAMES OF MY CHILDREN ON SILVER FLOWER TO YOU,VELANKANNI. 3.ONE YOUR STATUE FOR MY NEW HOUSE(SIGN FOR GOOD HUSBAND). 4.MANY MANY VISITS TO YOU. 5.PROMISE TO GIVE ME SOME POOR,UNWANTED,ORPHAN, UNDERGRADUATE CHILDREN. 6.IMPORTANT,GIVE ME ONE NICE JOB WITH GOOD SALARY(Rs:1,00,000 P/M)-AERONAUTICAL ENGG. THANK YOU. Tiruchanoor,Tirupati rural. 2014-06-26
christy madhave, theanks for giving us enquiries about the house. dear ma help us tofind out a suitable client without any problems help us to document the house very soon in a safe mode too. help us to avoid all evils coming towards us. today I am much afraid today because of one party's talk. nagercoil 2014-06-26
Maria Mother Mary please pray for me to get a good job. I beleive in you God. Please forgive my sins and bless me. Amen. New Delhi 2014-06-26
maniyan paramasivam amma. i am sorry for all my past bad behaviors amma. i really sorry for that amma. i apologize for that amma. i will be good amma. some times i do because i have not got all of my wants amma. amma. now lets start amma. if i get all of my wants asked you so far i stop doing all my bad things amma. i just believe in you amma and i will help as much as i can amma. amma. i submitted my wants to you through this website and asked you amma. i hope i got all of my wants amma. make my mind so intelligent, brilliant, very clever, very good memory power, very skillful, very good in thinking, never do mistakes, very healthy, never let any bad soul enter, inventing new new things, very fast thinking and very superb planning skills, very superb plan executing skills amma. i love you amma. i just come to you amma. i hope i got all of my wants amma. amma. i should be no.1 medical physicist in the world, and never loose my confidence and concentration, very happy always, very optimistic, very successful, very lucky, very fast and best future guesser, very good stamina, very good hand writing skills amma. studious, perfect , accuracy, getting good name from everyone, great and best planner and fast and best problem solving skills, amma. be with me and bless me amma. with your blessings maniyan paramasivam surat 2014-06-26
Sandra Dear Mother Mary, please pray for us... that there will be peace in the family, society Please bless Shawn that his girlfriend should not leave him again. Mumbai 2014-06-25
Fatima Dear Mother Mary Pray for us. That your child was loving someone but he has rejected her.. Bless that he will get good life partner better than me.. who loves him more than me.... and bless that both will understand each other and won't fight, there will be peace and love in their family Mother Mary Pray for us. Mumbai 2014-06-25
asha MATHAVE !!!ENTE MAKKAL NANNAYI PAREEKSHAYEZHUTHUVAN AVARE ANUGRAHIKKANAME!BLESS OUR FAMILY kerala 2014-06-25
christy dear ma, today come to u with great pain in heart. dear ma the things are going worse day by day. dear ma our regular customers are also going away from us. i can't recognise whether they find any fault from us or any fate pressing us? any way i surrender everyting to u ma. pray for us to remove all these unwanted thing near us. help us to find a bright future or the door which is opened for us . day before yesterday one party came giving us hope of new house documentation. but today i heard a neg. responce from him thrro sundari. dear ma help us to overcome this. we invested lakhs in the site. so we are in urge to document it but how and when i don't know. dear ma pray for us to ur son. your prayers will deliver us from all evil. i feel all who are dear to us in earlier are working against us. dear ma help us to find new jobs and to document the new house thanking you nagercoil 2014-06-25
K.T. MANISH Hail mary, mother of god, your full of grace our lord jesus is with you. Blessed are you among women and blessed is the fruit of your womb Jesus, Hail mary mother of god pray for us sinner now and at the hour of our death. Amen Please pray for me and my wife health. Last eight months i am troubled with some unknown anxiety which is troubling me a lot and as a result i have lost lot of weight and all my friend and family are asking me what is the problem. I even went medical check up and all is ok. Mother mary please make me normal and happy. i put all my trust into you and lord jesus. I believe and put all my trust into the lord. Pray for me mother mary. Manish and Suja Manish Chennai 2014-06-25
Jeevan Mother Please Pray for my Court Case settlement and let my document get accepted on 1st of july with evidence and plz try for compromise for the Land Case mumbai 2014-06-25
Sarojini Mother people say your are mother of good health i pray for my health and for a child. what health problem i am facing you might knowing nothing is hidden from you my faith towards to before and now is the same with that faith i want you to heel me with all my sickness and give me gift of god. my elder sister in law is searching of a job give her the job offer coming to her from your grace. Amen goa 2014-06-25
Baby Holy mother Mary, Kindly bless my son. Please intercede for us in prayers to Jesus Christ ,for help and guidance for further studies.Kindly see that we get all the documents in time and the admission process goes on well.Bless us with peace and happiness in family . Kottayam 2014-06-25
kavitha henry Mother Mary amma pls have mercy on my daughter amma pls bless in her study amms a she have to study nicely in the school she should not forge and any thing amma she have to be very smart amma she should come first in the class amma and I should not beet her amma I should love my both kids amma I should not get much angry at all amma pls bless me and help me amma help my daughter and pls pray for her amma in her study what ever I tell she have to listen amma I should love her amma because of her pls pray with Jesus Christ amma I should not get angry at all amma take my angry amma pls help my daughter in her study's amma amen. bangalore 2014-06-25
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2014-06-25
narayanasamy amma,deva madha save my daughter j n umadevi from her family problems and her mental problems. chennai 2014-06-25
jikku ariyilla ammae... pinnaeyum pinneyum.. enikku othiri sankadam varunnu.. ellaam marakkan enikku saadhikkanae.. athraykkum sankadam aayathonda... am not able to... pls help us ammae.. ammayudae eshtam enthaano athu nadakkanae... ammae maathaavae... maathaavae.. othiri sankadam varanu.. athondaa... plsss......... kerala 2014-06-25
Rupa Dear Mother, I come to thee once again for my mother's good health. She is getting her sugar and sonography done tomorrow. Please be with her and bless her with good health. All her reports should come normal and she should be in very good health, oh mother. All her pains and related problems should go. I always come to thee whenever I face any problems and I am sure that my mother mary will grant me the favour I ask of. With this trust, I seek your blessings once again for my mother's good health. Please help her oh mother and be with her always to protect her. Show us your miracle once again oh mother. Mah 2014-06-25
Nirmal Raj Dear Mother, Thanks for the everything which you have given in my life. Because of grace i came to Abroad & working in a company. Please take care of my family for their good health & mind. Now i am in confused about my job which i am asking u in my prayers. All my intentions i submit to You Mother. If u desire pls get it to me. But i thank you Mother for everything . Sharjah 2014-06-25
r kathu kollane mathave.koode undayirikkename mathave. i pray for my taproot meeting with llc today.please help me do a good job today .please please please be with me mat have.give me the intelligence and smarts to perform well and do a good ba job today. sc 2014-06-25
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-25
mm Ma Good Morning! Ma i thank and praise you for your blessings and mercy on me and on my family. Ma now i urgently and humbly request you to please hear the cry of this poor and take all my daughter's exam papers to the right hand and excell her in all her papers. Ma what you have not given me i dont regret but please bless my daughter abundently with peace joy and prosperity all material and spritual blessings. Thanks Ma. auh 2014-06-25
r dear mother i beg you for helping the money pending of raju gomez hamed essa & choclate person thank you mother for the miracle for solving the problem of al nusif,wwwl. you did the impossible mother thank you.help mother to get a house in solitare let it be blessed by you. mother help for r & r to be blesed with the =gift of a child mother nothing is impossible unto thee be our srength at our work place for c too help him mother.thank you for our holidayplan be wiht us als for mom and dad good health for ca & cl good helath let them not fight but be loving help me to loose soem weight for simaora and mara to go out of bad co for all the sick help us at our office mother m 2014-06-25
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness. mumbai 2014-06-25
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness. mumbai 2014-06-25
jojibabu mother i beg t u amma please forgive my sins amma in the naemof jesus christ i beg t u amma amma amma amen. amma my coluge daughter 12 yrs amma suffering cancer amma who r suffer cancer health probuelm accidental injuray amma i submit ur loved foots amma healing prasadinchu amma mother i beg beg beg beg give good health amma vari families kanniti tho suffer avvutunnai amma who r with out job amma i submit ur loved foots amma variki job prasadinchu amma job lo probulems tho vunna varini submit chesttunnau amma vari probulems slove cheyyi amma in the name of jesus christ i beg beg beg beg t u amma house ,site loan registration probulem tho vunnavarini submit chesttunnau amma please slove amma in the name of jesus christ i beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg t u amma mother i beg beg beg beg beg t u amma ur wish amma not my wish amma in the name of jesus christ i beg t u amma please amma mother i beg t u ur loved foots amma amen. hyderabad 2014-06-25
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-25
lavi Mother Mary Please help me uae 2014-06-25
henry mother mary my heartfelt thanks for giving good admissions to my driving school this week . thanks so much amma. my business should grow very fast amma. give me a good health amma . please bless my parents with good health . my daughter should study very well. my son should be very active. we should live very happily with your blessings. the unauthorised school should be closed . we should clear all our debts and take out all the jewelleriies we are pledged . kindly help us amma . bangalore 2014-06-25
maniyan paramasivam amma. i love you amma . i am really and extremely sorry for all my past bad behaviors amma. really i am sorry for that amam. amma. sometimes i did because i did not get my wants amma. be with me and bless me amma. i love you amma. make me so perfect and very intelligent , being no.1 medical physicist in the world, very good accuracy, very fast mind, very good memory power, never do mistakes, very good lucky always, very happy always, very calm and cool, never get depressed, never get fear, very good concentration and confidence, very prompt, very good fast acquiring skills, very patience, very healthy, very studious , very wise, brilliancy, intelligent, smart, clever, very fast problem solving skills, very good and best and fast future guessing skills and planning according to that, very good and best and fast planning skills, very fast and best plan executing skills, very good thinking, amma you should be always with me amma, very good creativity, everyone should respect me, good communication skills, very rational thinker, very clear and fast understanding mind, never be confused. very superb fast and best and correct understanding ability, very successful, getting good name from everyone, being so brilliant in front of everyone, very superb clear talking skills, never loose self esteem , very good communication skills, very good language skills, everyone should get fear of me doing wrong things, very perfect leadership skills, very good and best and fast and correct decision taking skills, amma. i love you . i submitted my wants to you amma. i hope i got all of them with your kind blessings amma. if i am blessed i will not do these bad things amma. really i will not make you disappoint you amma. i love you amma my amma. with your blessings maniyan paramasivam surat 2014-06-25
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. Tiruchanoor,Tirupati rural. 2014-06-25
AMD God, Please help my husband to get a stable job in IT as soon as possible with the salary he desires as he is in desperate need of it. Also, help him to shoot short movies as soon as possible as with good quality and low budget. Make a miracle so that he gets whatever best he needs in his budget as he very desperate. Help my husband to become a commercially successful director and producer very soon. Help me with my career so that it is stable and smooth going with good hike and career growth. Help me and my husband to repay the loan we have taken as soon as possible. Help us both to understand each other and be happy and healthy with each other India 2014-06-24
S Dear beloved mother Mary , mother please help me, mother please save me from all the stress and tensions I am bearing now, mother please help me, mother as I am not feeling well, I am suffering from severe wheezing, motherboard very weak and gave no barring th to do any work mother and I have a small child to take care of , mother please heal me, mother please have mercy and heal Me, mother do miracle and heal me , heal me totally whatever bothering me mother, and bless me with good health peace and happiness forever , mother please come to me mother I need you now mother touch me nd heal me mother, mother please be with us always mother, mother ease come into my life now , hold me heal me change me and strengthen me mother ,mother as u know due to my marriage issue my dad life totally and restricted my mom and all my family not to keep contacts with me, mother please help me , soften my dad heart now and reunite me my husband and my child with my parents and home and let my dad allow my mom and all my family to keep contacts with me, mother please hear my cry now, and please answer all my prayers now mother please and reunite us with my parents and home now and reunite us with my parents and home now ,and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this bin your name mother amen. bangalore 2014-06-24
S Dear beloved mother Mary , mother please help me, mother please save me from all the stress and tensions I am bearing now, mother please help me, mother as I am not feeling well, I am suffering from severe wheezing, motherboard very weak and gave no barring th to do any work mother and I have a small child to take care of , mother please heal me, mother please have mercy and heal Me, mother do miracle and heal me , heal me totally whatever bothering me mother, and bless me with good health peace and happiness forever , mother please come to me mother I need you now mother touch me nd heal me mother, mother please be with us always mother, mother ease come into my life now , hold me heal me change me and strengthen me mother ,mother as u know due to my marriage issue my dad life totally and restricted my mom and all my family not to keep contacts with me, mother please help me , soften my dad heart now and reunite me my husband and my child with my parents and home and let my dad allow my mom and all my family to keep contacts with me, mother please hear my cry now, and please answer all my prayers now mother please and reunite us with my parents and home now and reunite us with my parents and home now ,and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this bin your name mother amen. bangalore 2014-06-24
Maria Doss Roche Victor Thanks Mother Mary , Thanks for blessing my clients in New Zealand , Thanks for blessing the agency for coordinating , Thanks for Blessing my kochi Trip , Thanks for blessing my entire family , Thanks for holding hands through Trying times , Thanks for bestowing Holy Spirit upon us , Amen Chennai 2014-06-24
SHRUTHI Thank you mother for answering all my prayers i trust and believe in your mercy and love. Mother i beg you please answer our repeated request,help royal am me financially. WE are trying repeatedly to go abroad but it is not working pls help us and show us a guiding way. Evry time i have prayed and asked you have shown your mercy. PLease help roy give up drinking and becoming more responsible.pls give Dia more strength. And pls bless us so that we can come to Vailakanni with her. Please mother only you can help us. Amen bangalore 2014-06-24
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone , Thanks for blessing our clients in Newzealand , Thanks for making his trip better going forward, Amen Chennai 2014-06-24
racheal Ammathankyou so much for blessing us wid good results amma be wid us always amma thanku soo much amma dis time im a big sinner amma keep me safe from fowlers snare amma please forgive my sins amma help me to stay pure hearted amma,amma bless my parents b wid them amma we submit all our prblms in to your hands amma help us amma once again onb half of all my class mates amma i thank for your blessings amma continue being wid us.. Bless us munnar 2014-06-24
Aruna D'souza Father, From the past two months my 6 1/2 year old daughter hearing voices in her mind and after 7.30PM she will start crying loudly telling that she can't manage this the sounds are telling me to clean the house in the night, I can't sleep like that she is telling. We are very upset father, she was a very active child. We don't know what to do? Please pray for my child with Mother mary. I request you to please don't publish my name father. Thanks & Regards Aruna Mangalore 2014-06-24
stephen C Dear People of God, Pls pray to Jesus and Mother Mai to make my tour successful and give me safe journey . Thank you Jesus Praise you Jesus Love you Jesus- Servant of Jesus-stephen mumbai 2014-06-24
Jasmine Mathave, I expressed my feelings and worries about my mom and her health. Till now doctors couldn't come to a conclusion about the tumour. They have suggested about biopsy amma, I know you the loving mother of all humanity. Amma please help us. Let the biopsy test show that there is no cancerous tumour in her body. Amma, God the almighty can do miracles. You can change things. I have a strong faith in you amma. Pls help this poor soul amma. I ask this in the wonderful name of Jesus Christ. Saturday will be the result amma. Please talk to your son on behalf of me and my mom amma. Have mercy on us. KWT 2014-06-24
deepa Oh god I should get a govt job...I wrote my exams last week ...it was quite easy ...pls I be short listed in that ketala 2014-06-24
2014-06-24
mahesh Dear amma pleaseblessmy family.give good health to villiam moses vijaya kanna amma rishika and nanna.give rest in piece plasy.bless prawn pond give them good health.give me job amma.thankyou amma. varahapatnam 2014-06-24
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-24
JS Our loving mother, mother of Our God, I pray to you today to grant this favour. My daughter has signed a contract for an appartment. Your son knows the best for my daughter and only you can ask him to guide her. Please don't let my daughter fail in this matter. She had gone through many failures and the traumers had given her grief. Please let this be an encouraging for her in her life. She knows that I pray to you and through this she may know you more in her life. I am confident that my prayers will be acceptable to God almighty and will grant my request. I thank the Lord almight and you for all the graces given to my family and will be given inthe future as well. Praise the Lord. Thank you Australia 2014-06-24
kavitha henry Mother Mary pls have mercy on us amms,soon solve all my problems and and improve my business amma Every day we should have a admission in the office amma pls bless me to have a good business amma pls pray for and solve all my credit problems soon amma really I have big money problems amma No baddy is there to help me for the money amma pls have mercy on us amma I should take all my gold's in this year only amma so only you can solve my problems amma all the money matter day by day my interest is going up and up amma really I have very bad tension amma about the money if any one helps us in the money so I can give it back to them amma. I have my relative golds also amma not only my gold so that only I am very much tension amma ..pls pls I beg you to take and give me all the golds back amma pls I don't have any baddy to help me amma. Amma soon I should get one good job amma I should get the job without any certificate amma pls have mercy on us amma I should get the job in koromangala or indiranagar amma pls give me one good job amma so that I can solve some fincial problem amms pls bless me ammsamen. bangalore 2014-06-24
kavitha henry Mother Mary pls have mercy on me amma and bless my daughter and son amma the should study nicely and the should be first amma in every thing love them also be with them amma,and pls bless my office I should have more and more business amma my business is my life amma through this only I should take all my golds back from the should and soon I should buy car for my driving school amms know only I am having one car that is swift and I should buy ome Sandro soon amma and I should solve all my credit problems and I should take a site in bannerghatta road only and I should built s house in my own plan amma this all is for my daughter and son amma now only we have stated my new life amma so every thing in your hand only amms so pls love me amma today or tommrow I am going to tell my aunty that I am going to start the business amma for that she should not tell any thing amma and she should not open her mouth to tell any bad about my office amma pls what and all I have written pls bless for this amma every thing in your hand only amma only your my support amms for every thing amen. bangalore 2014-06-24
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA…… Bangalore 2014-06-24
mm Ma Good Morning and thanks, Ma Please send all my daughters papers to the right hands and let her excell in all her papers. Hear my prayers and grant me ma as nothing is impossible with you. Thanks Ma auh 2014-06-24
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, helpus get a good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-06-24
rosely ouseph Dear Mother Mary please pray for my daughter in law,she is pregnant 7 months now.Mary Ma protect her from all evils and enemies. I pray to get a normal delivery,please help us and forgive our sins. kerala 2014-06-24
ARCHAN SWETHA MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE VISIT TO VELANKANNI. Tiruchanoor,Tirupati rural. 2014-06-24
Christina Most Holy Mother please cover my Meghan's future with your mantle of protection. Help her get promoted to grade 7 & do well in her studies. Help us as parents to be a blessing to her. Pray that she has confidence and everything required to be a success in what ever she does. We believe God only gives the best and that is what we claim for our daughter, everything that is the best and good in Jesus holy name. Mama Mary our perpetual intercessor, hear our prayers and obtain our petitions. Amen. Dubai 2014-06-24
carol Dear mother, I ask of you in faith to please bless my son and help him to fair well in his exam tomorrow .please help him to get the job at the Harbur Meritton as a bakery chef .please help us to keep good health.We trust in you dear mother. mumbai 2014-06-24
maniyan paramasivam amma. i love you amma. i am sorry for all my past bad behaviors amma. be with me and bless me amma. i submitted my wants to you amma. i hope i got all of them amma. i need you to be with me and bless me forever amma. i love you amma. make my mind so pleasant and very brilliant and very creative , very successful , very fast, very wise, rational thinking, future guessing, good planning and plan executing skills, fast and best problem solver, i love you amma. i love you so much amma. be with me and bless me amma. i want you to be with me always and bless me amma. make me healthy, very successful, very lucky amma. i love you. with your blessings maniyan paramasivam surat 2014-06-24
MANIYAN PARAMASIVAM amma. i am sorry for all my bad behaviors amam. be with me and bless me amma. i throw all my bad habits from me if i get all of my wants asked you so far amma. i love you. i want you to be with me and bless me amma. i love you amma. i love you so much amma. i love you. with your blessings maniyan paramasivam. make me so intelligence, very good and creativity and very successful and very very lucky and very healthy amma. i love you. i submitted my wants to you through this website and asked you so far . if i get all of my wants i will be good amam. i should be no.1 medical physicist and scientist and very happy always amma. i love you amma. with your blessings maniyan paramasivam. surat 2014-06-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen -- 2014-06-23
gracy please for me to get job and bless me in everything open door show mercy on me hear my prayer give me peace please mother help me uk 2014-06-23
sm Dear all please pray for my wife.we married recently .my wife parents lied about her occupation (though wife hinted bit before marriage) ,however I never blamed her for anything .For me she is my blessed wife. But problem now is she is over attached with her mother long back from her childhood.After marriage she does the same thing by telling each and everything to mother even about sexual matters .outwardly she shows happiness to me and cooperated in everything.But after speaking all this to her mother she misinterpret everything and started creating problems in our life.her mother claims that I sexually abused her.but after checking with wife by others she said I had not done anything like that.Im born and brought up in a poor family with diseased parents and all wished for a peaceful married life.By Lords grace I got a Job abroad almost 1.5 years before and I brought wife two weeks before abroad after lot of paintaking .In my memory before I left hometown after one month she was happy .After few months delay she was totally changed by attachment with her mother.My wife stays with me but she share everything with her mother .she did not come close to me she hates sex with me as her mother told not to do or don’t have kid.Dear all Iam moving through a special situation like this .My wife never share her mind to me.sometimes I feel like acting also.I told her better leave to her mother but she doesn’t want that to do.Her mother never say to her anything like that she should follow what her husband says.Dear all I loved my wife than anything but when she behaves likes this my heart is stopping. Please pray for me .If we think of worldly parting is the solution .But im that much committed to lord .if My Lord given my soul partner Lord wish be to with her.But by doing this our both lifes are getting spoiled .So please pray for my family.Let her eyes open and she come to me .Also she exhibit high anger and different behavior which fears me .Also due to this through talks of her mother to my parents and relatives all are worried about my life and their diseseas worsening .My wife know my parents are poor but through the actions of her mother now she never talk to my parents and she wont live if they are with me.If there was anything bad done by them we could believe but in this case all know and she know nothing bad happened from them.She stands for her mother alone.Dear all Please pray for me .she cooks me everything but shows no affection or sex .She says that she loves me also.But if its not changed we don’t have a life .Also Please pray for all evil forces that plays in between both of us .Please pray for our married life to be happy and I believe that nothing is impossible for Lord.Let my wife apologise for everything and be cooperative to me and my family. I suspect that my wife was forced by her parents to tell about even our private bed matters or my wife itself was constantly telling all this.Her sister also also started turning to me saying bad words without knowing what is reality.But however now bit her sister understand that its fake and now not blaming me. Dear lord Im totally upset of this nature of my wife.I really believe her parents play with her life.she will obey what all things they say.they told her to lie of academics ,they told lie about her occupation and when things came complicated now her parents are compelling her to fetch a nursing job here by submitting fake documents and recommending by her other friends so that they can prove they never lied and she is a qualified nurse . Her parents send her wife relatives one night saying that I made a rape attempt to my wife and to release her from me . When her relatives came she told I didn’t do anything .All relatives of my wife came to know that she is not fit for Job. but now her parents plan that if somehow she get a nursing job here through their arrangement by creating fake documents .( Actually without knowing I gave money to wife for making university certificates .suspect she gave that money for fake certificates )so that they can prove they never lied to my family and they try to establish im a bad irresponsible husband..When situation coming worse I told my wife then if so let my wife leave from me.But she couldn’t do that cause she know im innocent and truly loving her.Also her mother told me my wife wont touch me until her mother says. Actually she is doing that to me now and spoiling our life.Dear all Please please pray for my family to reveal from her cunning parents and trust her husband.I know my lord my wife is afraid for doing a job she don’t know .she told me with open heart.but she is afraid of her parents.Lord Please strengthen her so that I wont lose your child .i don’t want to see her in misery due to projecting her lying parents and spoiling her life and my life . Lord please act soon so that let my wife understand the risks in doing a job without any training and be in trouble as she is staying in my dependent visa .Lord I understand that im sinner.but my family stood for truth and strongly leading a life in Lords belief.Im placed in a family were My fore fathers left their homes and all assests for working as missionary for Christ.My father and mother exactly leads a sacrificing life without complaining. My wife parents called them bad things by saying im a rapist and all that a mother cant accomadate.cause they know me without a drink or smoke I lived I kept all my morals though im a sinner .i was awake for my parents did any hard job to take care my parents spend all penny I have but I was coming happy that my lord arose then from too much disesed condition.but now seeing my married life this they are more paining.We have a small beautiful home gifted by Lord in land of relative given with open heart by lord.But now my wife parents blamed for my small home , I have nothing ,,,praise the Lord ..i know my wife can accomadate anywere with me .but these parents changed her mind that only until I make a multistoried building should shower a normal family life Lord please strengthen me …Please show the way I should move….i need by wife freed of all unwanted posions injected in her life …true to heart ..stopping saying lies for her parents…Lord interfere ..Lord I m thankful for everything in my life …Lord shower blessings …take us in your hand .Let lords wish happen in my life …Lord im happy and thankful to all given to me..Lord as you know I forgive to all who put me to dust but still all forcing to such a situation that I cant lift my head..lord so though I know I shouldn’t complain about my wife or anyone im forced to..cause I know this is not my lord planned for me..Lord please relese me from bond of evils .let both of us lead a praising life to lord and be a model to all that and also to bring all who are ignorant to lord by making my life experiences a model to see a miraculous life when all say there is no chance to me to rise ..praise the lord ..lord im thankful to all who prayed still praying for me .i realized power of prayer and lords doing several times in life ..but im failing to show that to my wife ..Lord shower thy blessings on me so that my wife also be strong in belief that nothing alone lords love is greater than all assests in world.to show her real kind heart outside .be kindful and loyal to my parents and family.she is now against giving money to poor .lord change her mind .Lord as you know I live by borrowed money so I cant do anything good now.Lord change my condition so that I could continue help with true heart without any ill feeling by my wife..i cant still satisfy some committed offerings cause im continually put in deep financial breaks due to over expenses due to illness , unnecessary spending on costumes and other modern things by my wife.Let her understand this is not the life by spending all for alone and worldy thinkings like drinking enjoying social networking or beauty.My wife is forced to wear small dresses by her parents so that her body get exposed to outsiders.i tried several ways to change but she sticks on that.i used to keep good moral values .i continually teach others word of lords love even that is haten by all.but when my wife wears small dress which exposes her inner garments also Im ashamed before all. Actually her parents masked her way of dressing before marriage by giving her look of a simple village girl.when almost marriage was fixed my wife told about her dressing but was too late to bring shame on her by rejecting because of that.Really her parents were playing between us since we were not able to see each other cause I need to leave abroad before due leave and we contacted only through phone.her parents convinced her that im okay with all her ways and she said she is interested.Even though I said all about me she didn’t read anything deeper.her parents were happy with my small home but when they started telling reverse to wife her mind got changed like this.I fear what was the intention of her parents to do like this.So lord please show me what was the motif of all to destroy our marriage like this..Lord help me your wish done in my life..Thank you for all praying for me kerala 2014-06-23
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing my family , Thanks for blessing us with peace , Thanks for blessing us with Good Health, Thanks for guarding us all the time , Thanks for blessing our cochin trip . Amen Chennai 2014-06-23
pugal i have many problem pls pray for me, i losse my mother & father,i now live in gardiyan house,my uncle have hand problem,i study college at sacred heart college,now many money problem, so pls pray for me and my village people,my village name B.PALLIPATTI ,thaks friends for me ,thanks u jesus pallipatti.b 2014-06-23
Vikto Amma pl help me from all my probs...save me from all the problems.help my family amma.u know wat is required for me nu amma.so pl help me amma......prayer is the powerful weaponj in this world amma.pl save my family rom all the problems amma India 2014-06-23
P.N.Gayatri Praveenkumar Amma please pray for our family blessing my daughter prasunna passed BCOM 2nd and on her face all acne and dark spots are there.and day by day she is becoming hefty and fat pls pray for flexiblity and activeness and she never sleeps in the night and sleeps during day and suffering with lot of anxity due to our financial tentions because of my husbands mistake debtors visiting our house ou debtors are sunitha, chinbai subbu, hanumanthu,padmarao,shanker,sanjay,narsing,and firstflight courier bills. we are suppose mortegage our house which is only 56 sqr yard pls pray so we get atlest 10Lks loan from any low intrest bank to clear our debts and expand our courier business and start our new bussiness of cloths and imitation jewellery and real estate from our home only.my son srinath is faild 9th standerd he is notintrested in studies amma pray for his studies and get admission in any goodschool so that he may continue his 10th standerd. pls mother pray to God Almighty for us salvation and conversion for our family members.pray for our wisdom holy sprit knowlodge and family prayer bible reading regularly going to church.pls bless a good house for my brotherRajesh christraj bless his childrens and his wife margret. my brothers Vinodfrank and his wife elezibathand their childrens . Susheel Jeorge and his wife racheland their childrens. my sister Niripa Papulu and her husband kishore and hhteir childrens. moher father motherinlaw fatherinlaw brother inlaw srinu and his wife sangeeta and their childrens and naveen my brother inlaw too.pray for all these so that they can come to our lord with one fold and one accord through jesus.bless our health.bless my husband to follow jesus and worship our real god almighty alone and quit drinking and smoking habit change my brother frank to give geniously to jeorge and christaraj and let christaraj ,frank jeorge give their share to buy new house to christaraj with out hindernes of their wives.bless franks painting contract business with good workers bless our five families health and prosperity.thankyou mother Amen house no 94a old mudfort near mahankali temple secunderabad 500009 2014-06-23
Arulraj amma,please forgive for my sins.keep our family members all healthy. sathyamangalam 2014-06-23
swapna john myself swapna john, from hyderbad, iam suffering from severe stomach ache since last 4 days, and not getting cure with any of the medecine. And i request you to pray for my results of 12th class exams, to get good marks, and join new course further. And i also request you to pray for all my family members. beleving our lady of mother, Based on all this request, if it is done, surely we will come to the church of our lady of 'VELANKANNI MATHA' in the month of september.kindly pray for my intension. secunderabad 2014-06-23
swapna john myself swapna john, from hyderbad, iam suffering from severe stomach ache since last 4 days, and not getting cure with any of the medecine. And i request you to pray for my results of 12th class exams, to get good marks, and join new course further. And i also request you to pray for all my family members. beleving our lady of mother, Based on all this request, if it is done, surely we will come to the church of our lady of 'VELANKANNI MATHA' in the month of september.kindly pray for my intension. secunderabad 2014-06-23
Liza Maathaavee.... Ente Ammakku nalla fever aanu..her sugar level is high too... Today one more test ... Pls Ammmmeee mathaave heal my mother... Ammmaye sughapeduthane.... Pls do this miracle for me.... Viral fever aayal mathi .... Give her good health... Pls protect my mother.. Mathaave pls give all of us good health.. I can't tolerate this headache... Protect my tony chettan and my son too... Mother pls give my friend back.... I am sooo sad... Pls mother... Thank you mother.... Klmsr 2014-06-23
mahesh Dear amma pleasebless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-23
kavitha henry Mother Mary pls have mercy on us amms,soon solve all my problems and and improve my business amma Every day we should have a admission in the office amma pls bless me to have a good business amma pls pray for and solve all my credit problems soon amma really I have big money problems amma No baddy is there to help me for the money amma pls have mercy on us amma I should take all my gold's in this year only amma so only you can solve my problems amma all the money matter day by day my interest is going up and up amma really I have very bad tension amma about the money if any one helps us in the money so I can give it back to them amma. I have my relative golds also amma not only my gold so that only I am very much tension amma ..pls pls I beg you to take and give me all the golds back amma pls I don't have any baddy to help me amma. Amma soon I should get one good job amma I should get the job without any certificate amma pls have mercy on us amma I should get the job in koromangala or indiranagar amma pls give me one good job amma so that I can solve some fincial problem amms pls bless me ammsamen. bangalore 2014-06-23
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-23
r dear mother i beg you for our office time to change mother let the satan v not have any meetings now with us help mother for all to go well help also mother for our sudden holiday planned bless mom with good health for her bones heal her touch her make her strong in yr love we need you mother bless oru trip to m'lore too and to india help c at his job place he is too much stressed and harrased help him to change his profile andhis job too mother help us to go for holy land trip before we leave this place help my children to say their prayers daily and trust in you.mother let v be busywith the meeting too let him not ask us anything in the meetings lord. we ask you forgiveness for all our sins. help stella & stacy in their procedure. mother we need you help both my children to eat well make them healthy and strong help our salary to be increased.mother you are our strength and our hope help us in the meeting that he doesnt conduct it this time keep v busy with some problems.thank you for the countletss blessings showered help us in india during the rainy season help me to go for some interviews too.help us in our financial situation its now many years my husband c hasnot got any increase in his salary let them give him some good work to do. mother help me to at my work place let the issue of al nusif, wwl& hamad essa payment to come only you can do this miracle for us mother we trust in you.take care of our health and our cycle too of our hormones you've done the impossible for us thank you mother at all times.help raju gomes shiment tocome to kwt without any problems.help us at our work place and help us to be good parents to our children heal us touch us change us help in our office no camer & recording to take place mother. fill us all with yr holy spirit and yr love your guiding force be w ith us and all the people over the world let satan not control them but only you. help kanchan to conceive with the gift of a child too. m 2014-06-23
sangameswari dear mother, kindly have mercy on me. mother i am in need of job. please grant me a good job so that i will be settled in my life. mother please grant me success in my life so that i will be getting a job soon. mother shower upon your mighty blessings over me..i will be very thankful to you if i get a job soon.. mother please kindly remember me and bless me. mother i am very much depressed without job and sometimes i feel like dying.. mother please grant me success in written exam for my job so that i will be getting that job soon..please remember your child visakhapatnam 2014-06-23
carol Dear mother, please bless my son and help him to do well in his exam today .please bless him with the job at the harbur meritton .please help us with good health.we trust in you dear mother for this. mumbai 2014-06-23
mm Ma, Good Morning! Ma Please bless my daughter and give her easy paper today and take all her papers to the right hands and bless her ma with excellent marks. Thanks Ma auh 2014-06-23
maniyan paramasivam amma. i am sorry for all my bad behaviors amma. be with me and bless me amma. i come to youa mam. i am your divine son amma. i am sorry for all my bad behaviors amma. i love you amma. make my mind so intelligent and brilliant amma. i love you amma. i love you so much amma. i want you to be with me always and bless me always amma. i am sorry for my bad behaviors amma. i am your son . if i get all of my wants i will not do these bad things again amma. i love you. if i really i get all of my wants i will really not do these bad things amma. i love you amam. i just believe in you amma. with your blessings maniyan paramasivam surat 2014-06-23
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-23
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy helathy married life.Mother please bless my son good health, make him peaceful and normal child. Mother pleease bless avi n me good health, make us peaceful, free us of all worries, free tension good house, good increment. Mother please free avi n me of all worries n tension. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness. mumbai 2014-06-23
MANIYAN PARAMASIVAM AMMA. I LOVE YOU AMMA. I AM SORRY FOR ALL MY BAD BEHAVIORS AMMA. BE WITH ME AND BLESS ME AMMA. I WANT YOU TO BE WITH ME AND BLESS ME AMMA. I LOVE YOU AMMA. MAKE MY MIND SO PERFECT AND INTELLIGENT AND VERY CLEVER AMMA. MAKE ME SO HAPPY AND VERY HEALTHY, EVERYONE SHOULD RESPECT ME , ALWAYS VERY SUCCESSFUL, AMMA. I SUBMITTED MY WANTS TO YOU THROUGH THIS WEBSITE AND ASKED YOU SO FAR AMMA. I HOPE I GOT ALL OF MY WANTS AMMA. I LOVE YOU AMMA. BE WITH ME AND BLESS ME AMMA. WITH YOUR BLESSINGS MANIYAN PARAMASIVAM SURAT 2014-06-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2014-06-23
JOHNSON MATHEW Matahve Ente Visa Expiry aavunathinnu Munpe Nalla oru Joliyil Praveshippan Mathavu edayakaname....Athodoppam ennieum ente Pappa,Mummy,Anishchan,Remiya Chechi,Ashima Moleium thirumunppil Samarpikunnu,Aapathil Ninnum anarthagalil ninnum rogathil ninnum viduvichu kaathukolaname..amen UAE 2014-06-23
bephy mother mary,please pray for my family and all..main request that my partner want to become a orthodox priest..give blessings to him..we wants to come more near to God.. kerala 2014-06-23
Sheela Thomas Mathave kathukollaneme.Ente makalude marriage nadannukittaname. Avalkuvendi abhekshikename. Ennte prarthana sadhichu tharaname. Ahmedabad 2014-06-22
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake me and my loved ones. -- 2014-06-22
Jasmine Amma, I thank you for all your help in all my needs. Amma, again I'm surrendering myself for helping my mom. Amma, you gave me a wonderful mom like you to sacrifice her life for us. my mom is struggling now with a tumour in her breast amma. Tomorrow she is going for a test. Please amma, let the tumour she has should be a benign one not the dangerous one. I beg you amma for her health and life. she has a big responsibility of taking care of my dad amma. Thaye only you can help her in this situation. Help us amma. I will be waiting for the reply to write a thankful note amma. I will bring her to your feet in the following week only to meet you. Have mercy on us amma. All these I ask in the wonderful name of your son Jesus Christ. Hail Mary. KWT 2014-06-22
Jas Mathave, we have planned to start our house construction within two months. Let your presence be with us. and let us do our work as we planned. We seek your blessings throughout the building constructions and in our house also. Pls help us to start our construction work as our plan amma. Help us. Nagercoil 2014-06-22
Saby Mathave, Ente Amma Now i am 20weeks pregnant, My dearest and loving mother pls give me a normal good delivery, with out any complications and please protect myself and give me healthy baby Ente Amme Ennayum , udhrathil ulla kunjinayum Kathukolaname, BANGALORE 2014-06-22
victor arthesamyl Dear mother mary pls bless my family with good health.im suffering to find a good job.pls bless me to get new job fast.im struggling with my current job.pls bless my family with good health n happiness in my life.deliver us from all the evils n sufferings. malaysia 2014-06-22
kavitha henry Mother Mary have mercy on us amma pls blesson e amma today I went Antony's church with my son first time , son Came fist first to Antony church amma pls improve my business and I should have more admission amma pls bless us amma amen. bangalore 2014-06-22
2014-06-22
SM Please pray for me that Smv really loves me and Li is fully co-operative and welcoming and that she stops fighting and abusing, pray that God changes her fully and also Man and Helen, that RS travels safely and happily and that the apt sale is done to my satisfaction and CRM does not cheat and returns all that is due to me and for my healing.and blessings for Susan and children for a perfect score for Ale. M 2014-06-22
mahesh Dear amma please bless my family.give good health to vijya kanna rishika amma and nanna.bless prawn pond they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-22
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-22
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free of all tension, good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless us get a good full time maid. Mother please bless avi n me of good health n job satisfaciton. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness. mumbai 2014-06-22
Maria Doss Roche Victor Nandri Mother Mary , Thanks for blessing My Mother , Thanks for blessing my Brother and his Family , Thanks for blessing Margret , Alfred & leonard, Thanks mother for the holy spirit Showered upon us Amen Chennai 2014-06-22
mm Ma Good Morning and thanks Ma, Ma please haste to help my daughter to do her exams well help her to retain all that she studied and write well in her exams. Please take her papers to the right hands and excell her in all the papers and be the gold medalist Ma. Ma bless her body and mind and be with her. Please haste to help her. Holy spirit help her. Thanks Ma auh 2014-06-22
stephen C Dear People of God, Please pray to Jesus and Mother Mai to bless all my work for this week and do not allow any interference from any other depts. Please also bless my overseas trip for the week with safe travel and arrival. mumbai 2014-06-22
carol Dear mother,I ask of you in deep faith to please bless my son help him to do well in his exam today please help him to get the job at the harbour meritton .hellp him to keep good health .please bless us with good health.we trust in you dear mother. mumbai 2014-06-22
r mathave, thank you so much for blessing me with A in 349 and 509. thank you so much for bringing g back for aaron.thank you so much for being the guiding light in my life.thank you for your love, kindness and blessings.father lord, lord jesus, holy spirit, appe, kaval malakhamare, kanyattunirappu muthappanmare, st antony appacha, st jude appacha thank you.please continue to be with me when i apply for jobs in october. sc 2014-06-22
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,godo wealth,peace of mind,and protect us from all evils,dangers and accidents and forgive our sins and forgive those who sin aginst us.My saviour bless this monday and this week with peace of mind,sucess and protect me from allproblems ,issues and give me strenght and confidence to work hard and prove myself in mfront my boss my team and my CEO who alway shas bad opininion about me and my dept,my saviour dont le tem down coem to my aid bless me with sucess and please give me strenght o fight against all odds and prove my worth in this company and mother mary my saviour am in real deep problems where i dont know whether it was my mistake or others msitake but it will fall on me and i need your blessign to save me form this problems and shwo me way for that,am suffereing from mental depression because of this problems and not i dotn haev job right now if they throw me out please dont le me down i'll die if i lose this job or if they insult me or humilae me ,please give me confidence and strenght help me to built good relatonship with my team ,my CEO my boss and my all my family memebrs ,get angry for small things and i i abuse everyone ,please show give me strenght and bless me to control my ego,aggranace and help me to overcome all my problems and issues and save me job i have just completed not even two yrs i have three months to go please come to me and show me a way,mother mary i got one interview but they also stopped respondign to me ,i dont have a another job for me,pls show me way and bless all my meetings and communcuation with my CEO adn my boss to be safe adn usefull adn they trust me ,the day they lose trust on me am out of this company.My saviour help me to overcome all my problems and issues and guide me to take right descions and save my job,my sviour come to me dont let me down i beg yu mothe mary saveme form all the problems and pls forgive me for talkign ill about others adn putting people down ,this has really reflected back on me. MOther Mary your right jdge to decide who insults me or humilates me and your right person to punish them or forgie them ,but it reallu hurts me so much am die everyday interanllly you know everythign but pls save me i'll work hard and i promise once my jewels come out and i pay back the cop i'll not lend my hand in front of anyone it's my promise and i mean please this one time my saviour help me get back my wif'esjewels and pay back that cop as committed adn if my problem of IPAD is sovle and i get better job inthe compnay where i had gone for interview i'll coem to your shrine shave my head and kneel coem to your holy tank ,its my promise.Bless my wife and daughter with good healtha dn peace adn give thema ll happiness and strengh to bear with me ,because of me they are alone sufferings,i havent seen my daughter grwoing ,she has grwon bless her and protect her fromall evils,bad life adn give her good education and good career grwoth and bles smy wife woth good ehalth adn pls give her long life because she doen so much for me and its all because of my mistake and foolishness.My saviour dotn let me down in your naem am startign my day and my meetign adn this week pls be with me and protect me adn give me strenght and confidence to work hard adn fight agsinst all problems and issues. Mother Mary my saviour please come to me be with me adn save me form all issues and forgive me for my sins and bless me with good health. In your name am startign my meetign with my CEO/my boss and i thank you for giving me another day and allthese luxuires in my life. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, St.Anthony beloved of god and man pray for us. Everythreatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2014-06-22
carol Dear mother, thank you very very much my son exam went off ok today .please bless him for his tomorrows exam. I trust in you dear mother for this. mumbai 2014-06-22
christy amme madhave, hear the prayers of ur children. may be our situation or fate. dear ma show us a way to walk. we feel all ways are ended. how many miracles are done everyday for your children ma. can't you pray for us too.dear ma, we beg u, we surrender us to u. we ask you. we will come to u to say thanks when we get chance. dear ma we have a lot of problems in our profession. no new work for more than one year. now we send employees. dear ma i can't understand where we go wrong. dear ma help us to overcome this. the new house built was not yet advanced. dear ma help us to document it within this week.. dear ma our hearts are with pain. we never come acroos such situation till now i think. many works are comming but not finalised. dear ma help us to find mre works and there by to solve the problems. our vehicle is comsuming more money and it need to exchange. our offices are free without customers. our supervisors are free without works. i canregognise something is happening to us which is not desirable. dear ma help us to come out of this. legal problems are also fighing with us. dear ma, i beg u, i beg u, help us to put atleast advance today for the newly built house. dear ma help us help us, pray for us pray for us.....with the hope that i can give heart full of thanks tomorrow your daughter nagercoil 2014-06-22
sangameswari dear mother, thanks for your love and effect ion. mother I'm going to write exam in the next month for a job. mother kindly bless me so that i will perform in that in a nice manner and come out with flying colors. mother please help me with good knowledge and wisdom kindly be with me and help me in that exam..mother i will be greatly thankful to you if you grant me that job. shower upon your mighty blessing over me and kindly be with me mother..bless me with that job for which i am eagerly waiting visakhapatnam 2014-06-22
PRASANTH VERY VERY URGENT PRAYER REQUEST FOR PRASANTH. --------------------------------------------------------------------------------------------------------------------------- Prasanth is sick with blood pressure. So doctor ordered lot of tests. Please pray for Prasanth's blood pressure test will become complete Normal by Prayer only without Medicine. Prasanth had a complete blood test and complete Urine test FRIDAY. Please pray that Prasanth's blood sugar test RESULT will become completly Normal by your prayer. Please pray that Prasanth's liver test result will become completly NORMAL BY YOUR PRAYER., Kidney test result WILL BECOME COMPLETLY normal BY YOUR prayer., Cholestrol test result WILL BECOME COMPLETLY NORMAL BY YOUR PRAYER., Heart test result WILL BECOME COMPLETLY NORMAL BY YOUR PRAYER. and all other blood test result WILL BECOME COMPLETLY NORMAL BY YOUR PRAYER.and Protein in Urine test result WILL BECOME COMPLETLY NORMAL BY YOUR PRAYER.and Albumin test result WILL BECOME COMPLETLY NORMAL BY YOUR PRAYER.and all other Urine test result will become Completly Normal BY YOUR PRAYER.and infection in the blood test result will become complete Normal by YOUR prayer so that get peace in mind and for Praise God for everything. PRASANTH is sick with high blood pressure. So doctor ordered complete blood test and Complete urine test. Please pray that Prasanth's following blood test Result and Urine test Result will become completely NORMAL by your prayer. . ORGAN OR DISEASE PANELS. --------------------------------------------- 1). Comp Metabolic Panel (14) 80053 (GEL). 2) Lipid Panel 80061 (GEL) HEMATOLOGY ----------------------- 3)CBC w Diff w Plt ALPHABETICAL/ COMBINATION TESTS. ----------------------------------------------------- 4)HCV Ab w / Rflx to Ab Verification 86803 (GEL) 5)TSH, 3rd generation 84443 (GEL) MICROBIOLOGY ----------------------- NuSwab Tests ------------------------- 6) Ct/Ng/Tv Please please urgently pray that the above lab test for Prasanth will become completly Normal by your prayer. Please please urgently pray that Prasanth's blood pressure will become Completly NORMAL by your PRAYER. usa 2014-06-22
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-22
lavi Mother Mary Bless me and my family.Pray for me my personal needs. uae 2014-06-22
stephen C Dear People Of God, Thank you very much Jesus, Mother Mai and all you people of God for all the Blessing, petitions and grace i received during this week.Thank you very very much. Than you Jesus praise you Jesus love you Jesus- Servant of Jesus - stephen mumbai 2014-06-21
henry mother mary please bless my father with good health. he should get cured without operation. i should not have any health problems . my leg swelling should go away. please bless us. amen. bangalore 2014-06-21
Alphy Amme ninaku orayiram nanni, amme ente pray entha amme nee kelkathe,njan ninnodu yachikuva amme,ente roomnu nalla oru vadakakare kondu tarane,amme ethrayum vegam tarane,karthik nu cash kodukan ullatha amme ,ellavarum vannu nokiyittu pokum pakshe aarum edukunnilla,amme nee ente pray kettu nalethanne eniku room nu rent kara kondu ethikane amme, ente makal nannayi padikane,amme njan father nodu samsarikumpole ente makalku kurachu fees concession kittane,amme ninaku orayiram nanni,ellavareyum kathukollane,yathoru aapathonnum varuthalle ,eniku job num problems onnum undakaruthe,amme nanni amme othiri othiri chakarayumma Mumbai 2014-06-21
Fernandes Mother Mary, please bless me to find a good band with good people, good health, peace and divine protection. I lift up to my neighbour lady who is troubling us, blaming us falsely and who has created a big discord in the family. Please keep us away from this evil person and dont let whatever she is planning against us to succeed. Please bless us with your divine protection and keep all the evil people away from us always. Thank you very much for saving our dog who was very very ill. He was healed after the application of the blessed oil from Velankanni and after licking it from my hand.Thank you for all your blessings Mother Mary for never ever letting me down whenever i have called out to my mother. Goa 2014-06-21
Fernandes Mother Mary, please protect us as we see snakes around our house. Please protect us and keep us safe and sound from them. Thank you for saving me from the one which was very close to my feet yesterday.Please cover me and my family with your mantle forever. Than you Mother Mary. goa 2014-06-21
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-06-21
Shilpa oh my lord please forgive all my mistakes. please give my praveen back to my life. i cant live without him. please please. i want to see him and talk to him please give me a chance kerala 2014-06-21
Claret Pinto Dear Lord, Please help me to overcome the tension I am going thru with my wife and me. Lord, help her to have a normal, health and non-complicated pregnancy. Please pray for a healthy and normal delivery. Please pray for me for my parents for their health, peace, joy, love and happiness. They are little depressed. Help Mom and Dad to overcome the problem Prayer for my younger sister for her Job, peace, love and happiness. Please Lord, let her overcome all hurdle from her job related. Prayer for the sister, her husband and her baby. Prayer for their intention. Please pray for my Job and all my related intention. Lord help me for my job, Owners representative, Management. Help me Jesus. Prayer for my aunts well being. Prayer for all purgatory. Relieve them for all sin. India 2014-06-21
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna .bless prawn pond give them good health.they have to take feed properly.give me job amma.thankyou amma. varahapatnam 2014-06-21
mm Amma, Please help my daughter and be with her all through her exams, bless and give her the strength of mind and body and please send all her papers to the right hands and excell her hard work Ma as nothing is impossible with you. as you are v v powerful mother of the universe. thanks Ma auh 2014-06-21
siby Dear all please pray for my wife.we married recently .my wife parents lied about her occupation (though wife hinted bit before marriage) ,however I never blamed her for anything .For me she is my blessed wife. But problem now is she is over attached with her mother long back from her childhood.After marriage she does the same thing by telling each and everything to mother even about sexual matters .outwardly she shows happiness to me and cooperated in everything.But after speaking all this to her mother she misinterpret everything and started creating problems in our life.her mother claims that I sexually abused her.but after checking with wife by others she said I had not done anything like that.Im born and brought up in a poor family with diseased parents and all wished for a peaceful married life.By Lords grace I got a Job abroad almost 1.5 years before and I brought wife two weeks before abroad after lot of paintaking .In my memory before I left hometown after one month she was happy .After few months delay she was totally changed by attachment with her mother.My wife stays with me but she share everything with her mother .she did not come close to me she hates sex with me as her mother told not to do or don’t have kid.Dear all Iam moving through a special situation like this .My wife never share her mind to me.sometimes I feel like acting also.I told her better leave to her mother but she doesn’t want that to do.Her mother never say to her anything like that she should follow what her husband says.Dear all I loved my wife than anything but when she behaves likes this my heart is stopping. Please pray for me .If we think of worldly parting is the solution .But im that much committed to lord .if My Lord given my soul partner Lord wish me to me with her.But by doing this our both lifes are getting spoiled .So please pray for my family.Let her eyes open and she come to me .Also she exhibit high anger and different behavior which fears me .Also due to this through talks of her mother to my parents and relatives all are worried about my life and diseseas worsening soon.My wife know my parents are poor but through the actions of her mother now she never talk to my parents and she wont live if they are with me.If there was anything bad done by them we could believe but in this case all know and she know nothing bad happened from them.She stands for her mother alone.Dear all Please pray for me .she cooks me everything but shows no affection or sex .She says that she loves me also.But if its not changed we don’t have a life .Also Please pray for all evil forces that plays in between both of us .Please pray for our married life to be very happy and I believe that nothing is impossible for Lord.Let my wife apologise for everything and be cooperative to me and my family.thank you all for praying for me bahrain 2014-06-21
Anon Blessed Mother Mary, ever virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and all people that pray and seek Your Divine assistance. Amen. -- 2014-06-20
asha BLESS MY DAUGHTERS TO DO THE EXAMS VERY WELL.HAVE MERCY ON US.MATHAVE!!!! NJANGALE KAIVIDALLE !!!YOU ARE OUR HQPE kerala 2014-06-20
asha BLESS MY DAUGHTERS TO DO THE EXAMS VERY WELL.HAVE MERCY ON US.MATHAVE!!!! NJANGALE KAIVIDALLE !!!YOU ARE OUR HQPE kerala 2014-06-20
liza my dearest mother.... pls have mercy on me... i feel so sad.. pls bless my family with good health.. pls be with tony chettan and protect him... mother pls guide me... i want peace of mind mother... i need my friend back.. pls help mother.. pls help my friend to analyse the situation.. mother pls do this miracle for me... thank you dear mom... KLMSR 2014-06-20
kavitha henry Mother Mary pls have mercy on us amma pls bless me amma my business should happen nicely amma soon I have to solve all my problems amma bless and help me to get the money from some one amma pls love me and my family And bless daughter and son amma the have study nicely without any problem amma the soon solve my money problem amma and always bless my daughter and son and be with them amma love them amma soon from the shop I have to take all the golds amma pls arrange me for the money amma and my son should grow nicely and every thing should be perfect for him and when is growing is teeth should be inside amma and he should be very fair amma and my daughter and son both should be very smart amma they should be very big person and the should stand in there own leg and they both should be very rich amma and they should help others amma the should be.very big person amma pls help them and love them amma always we need your help amma..amma bless my office and give me more business day by day amma people should know my office and they should come more and more amma pls pls because of me pls pray to Jesus Christ that for my daughter all the problems should solve soon and she have to take back all her golds from the shop amma . Amen bangalore 2014-06-20
lavita mama mary i thank n praise u for all the blessings u have showered upon me n my families . mama mary i surrender u my mumi,her hard wrk,good health,peace of mind .etc...mama my mother i surrender u jo ,her studies her carrer,good heath,mind body,soul.lord i thank n praise u for helping me finish my vivas,procedures.mama as il b writing my model exams help me to prepare well for my exam n do well.be with me and my fly members always..alwys help me in my studies and do well both in studies n other activities. manglore 2014-06-20
sangameswari dear mother, thankyou soo much for your love and effection. i got good marks in my engineering but i did not pass in one subject. I'm very much worried about this,i don't know what to do. mother please help me,shower upon your mighty blessings over me,show mercy on me..mother please grant me a good job soon. mother I'm very much awaiting for a job. please grant me a job soon so that i get settled in my life soon..please mother show mercy on me..listen my prayers mother please. visakhapatnam 2014-06-20
r kathu kollane mathave.koode undayirikkename.amme i pray for an A grade in 349 and 509. i pray for aaron that he may be healthy, well behaved, happy and safe.mathave thank you for your love and kindness, i surrender everything in your hands.nanma varuthename amme.apapthonnum varuthathe nokkename amme. sc 2014-06-20
kavitha henry Mother Mary pls have Mercy on us amma pls give my daughter good memory power to study Amma pls bless her amma in our study amma she have read nicely amma she have to study in the icici amma till 10th standard amma pls be with her amma she have be in our study smart amma I don't have that study knowledge amma atleas my daughter should be smart in the study amma pls blessamma. bangalore 2014-06-20
ஆனந்த் அன்பும் கருணையும் நிறைந்த தாயே.. என்னுடைய வேண்டுதலை கேட்டு என் மனைவியின் வழிகளை போக்கி உடல் நிலையை சீராக்கிய உமக்கும் எங்கள் ஆண்டவராகிய தந்தை இயேசு கிறிஸ்துவுக்கும் நன்றி. அமென்! Puducherry 2014-06-20
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma here I request prayer for my elder daughter who suffering from severe stomach pain ma,please touch and heal her ma.Ma since past six month she is suffering from stomach pain ma,if she done anything against us forgive her touch and heal her ma.Ma tomorrow when she get up from her bed her stomach pain should be completely take away ma,show your miracle on her ma,kindly show mercy on her ma.Thank you ma. TVC 2014-06-20
2014-06-20
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-20
Sha Thaye guide all of us. My son, my brother and his son. Guide them all through their trip. Canada 2014-06-20
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2014-06-20
Maria Doss Roche Victor Nandri Madhavee, Thanks for giving us good health , Thanks for blessing every one in this world . Amen Chennai 2014-06-20
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job, help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless us get agood full time maid. Mother please bless free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happines. mumbai 2014-06-20
kavitha henry Mother Mary pls have mercy on us amma my daughter have to study nicely amma pls what and all she leaning every thing she have to rember she should not forget any thing amma pls give her good memory love them help them amma She have to be first in the class amma be with her amma always in every were she goes amma.pls help me in business to get more admission amma I have to take golds bangalore 2014-06-20
sangameswari dear mother, have mercy on me. please help me to pass in my only backlog subject. without passing that subject i can't study my m.tech. mother i got very good rank in my m.tech entrance but if i did not pass in that backlog i can't study m.tech..please pass me in that subject mother..have mercy on me..my mother should not get angry on me because of that..please save me from that scoldings.. visakhapatnam 2014-06-20
maniyan paramasivam amma. i just believe in you amma and i am going to be good amma. i love youa mam. i submitted my wants so far to you through this website and asked you so far amma. i hope i got all of them amma. be with me and bless me amam. i love you amma. with your blessings maniyan paramasivam. i will be good . i am your son amma. i am sorry for all my past bad behaviors amma. i will be good amma. be with me and bless me amma. i want you to be with me and bless me always amma. i love you. i just believe in you amma and i hope i got all of my wants amma. i love you ... surat 2014-06-19
Archan Swetha MARYMATHA STOTRAM IAM FINE NOW.THANK YOU,MOTHER MARY. MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH ONE VISIT TO VELANKANNI,MOTHER MARY.PLEASE.... TIRUCHANOOR,TIRUPATI RURAL 2014-06-19
Archan Swetha MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS JOBBIN WITH THE GIRL,HE LIKE. I KNOW I LIT LAMP IN ANJANEYULU SWAMY TEMPLE EVERY SUNDAY AND FRIDAY. IF IT IS WRITTEN IN MY FATE THAT I SHOULD GET MARRIED,THEN THERE WILL BE SUITABLE BOY FOR ME BY NOW. ANYWAY,I DON'T WANT TO GET MARRIED FOR 2 YEARS. THANK YOU. TIRUCHANOOR,TIRUPATI RURAL 2014-06-19
Wilma Dear Mother , I am anxious to know my assessment results.Please let me know my result and help to proceed further without any complications. Mother please bless me,my family and everyone who need your grace. Dubai 2014-06-19
Maria Doss Roche Victor Nandri Mother Mary , Thanks for sorting out the Loan issue , Thanks mother for guiding me through , Amen Chennai 2014-06-19
Baby Mathave , Kindly Bless my son.Kindly pray to Jesus to help for further studies.Please be with us every moment so that admission process goes on smoothly.Kindly intercede fo us to get all certificates in time .Please Bless us with peace and happiness.Amen. kottayam 2014-06-19
Maria Doss Roche Victor Thanks Madhavee, For blessing my Mother Amen Chennai 2014-06-19
Archan Swetha MARYMATHA STOTRAM NENU JOBBIN NI YEVVANU.AA AMMAYE MANCHIDI KADU,ADI DEYAM. PLEASE MOTHER MARY,NEEKU TELIYAEDEMEE LEDU. NAKU VAADU AMENI PELLI CHESUKOVADAM NAKU ESHTAM LEDU. PODDUNA NAA MANASU CHAMPUKONI CHEPPA. TIRUCHANOOR,TIRUPATI RURAL 2014-06-19
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2014-06-19
sampathkumar.talamala Respected Father, My Mother left on 14 - 12 - 2011,today birthday of my mother,so please pray for her soul to be rest in peace.My mother name is AGNES LALITHA. thanking you, sampth Hyderabad 2014-06-19
rosely ouseph Oh Mother Mary please pray for my children to get good health and do their job with god,s grace,protect them from all evils and enemies,forgive our sins.Help them difficult time and give them wealth&wise. kerala 2014-06-19
r kathu kollane mathave.koode undayirikkename amme.please please please be with me amma and help with my 349 and 509 grades.Amma i want to get an A grade in both for a 3.5gpa.amma i pray for aaron that he may be happy, healthy and safe.kathu kollane mathave.please be with me all the days of my life. s 2014-06-19
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond.give good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-19
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-06-19
henry mother mary please bless my father with good health. he should get cured from this problem without operation . please solve our money problem. we should get good admissions and enquiries today.bless us. bangalore 2014-06-19
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing everyone in this world, Thanks for blessing my clients who are traveling , Nandri Madhavee, Amen Chennai 2014-06-19
stephen C Dear People of God, Please pray to Jesus and Mother Mai to heal all sick and weak people in our family, friends , relatives and all those who may need our prayers. Please heal them Jesus. Thank you Jesus Praise you Jesus love you Jesus. Servant of Jesus-stephen mumbai 2014-06-19
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful,free us of all worries, help us in our job, help us get a good house, good increment, good promotion. mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness mumbai 2014-06-19
christy dear amme madhave, thankyou verymuch for the favours given to us by your prayer to Lord. dear ma now we go thro' a very critical situation. amma pray for us. i don't know what to do. what to act. who to beleive etc. dear ma we are in a pit in our profession. we have no works. jk is much upset and everytime in house. very very sorry to see this dear ma, pls bring this to end. we cannot move forward happily by this situation. our new house also is not yet moved. we feel we have a bad time. dear ma pray for us strongly. your words are heard in front of your son Jesus Christ and Lord almighty. dear ma your children calling from here. we are struggling a lot nowadays. pls help us. pls pray for us. nagercoil 2014-06-19
Archan Swetha MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH ONE VISIT TO VELANKANNI. PLEASE MOTHER MARY..... TIRUCHANOOR,TIRUPATI RURAL 2014-06-19
asha MATHAVE !!!BLESS MY DAUGHTERS ALINA AND ALISHA TO WRITE THE EXAMS WELL AND SCORE GOOD MARKS kerala 2014-06-18
lavi Mother Mary bless me and pray for me my personal needs. uae 2014-06-18
asha MATHAVE!! THANKS FOR ALL BLESSINGS .BLESS OUR FAMILY WITH PEACE,LOVE.HAPPINESS AND GOOD HEALTH kerala 2014-06-18
2014-06-18
v Amma Madhave, our family is facing lot of problems from long days y ma v r ur kids please dont test us a lot v r fade up of problems. amma my sister got married to her loved boy but after marriage she had an abortion and now her husband has sent her to my mothers home and he is telling that he is not willing to be with her and he is asking for a divorce , i know u r watching all this things but y mother from my knowledge even that guy is a good boy please amma i beg u please help my sister sure i wil get her to velankanni ma please save my sisters life ave maria ave maria ave maria ave maria ave maria ave maria ave maria t 2014-06-18
a amma my daughter is telling she is having stomach ache comes and goes amma please take care keep ur hand on my daughters stomach now and pray and bless her for ever nothig should be ther my mother i believe u more then anything ma . y 2014-06-18
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-06-18
Rohan Daniel Nair Dear Mother, Thanks you for your blessing mother. Please help me save mother, i need your help for the rest of my life. I believe in you and you loving son Jesus Rohan MH 2014-06-18
kavitha henry Mother Mary pls have mercy on me ammapls pls adjest me some money to take the golds from the shop amma soon I want to take all the golds amma before my aunty comes from the shop amma pls pray for me soon I have to take all the gold from the shop amma bangalore 2014-06-18
elizabeth Kindly please pray for my health,both mental and physical.facing problem with my eye specially.I am really worried. tripura 2014-06-18
Brent Please pray for the Repose of the Soul of William Clayton Keith. Pax Christi, Ave Maria USA 2014-06-18
S Dear beloved mother Mary, mother please help me , mother please save me from all the tensions and stress I am bearing now, mother as u know everything about me, mother my child is 3.5 years old , mother he is very stubborn and he is not concentrating on a particular thing he always runs everywhere we almost tired run behind him and in school teachers told that he didn't sit in the classroom he roam in the classroom and disturb other kids too, mother please help me mother , I am totally depressed due to his behaviour, mother please bless my child with good behaviour mother , please mother do miracle now and change my child aggressive behaviour mother, mother please let my child understand what me and his dad trying to tell him, mother please bless my child with good concentration and behave nicely with everyone, and please bless my child concentrate in class room and stop roaming in the class and cooperate his teachers in school,mother touch my child now and heal him what er bothering him, mother and bless my child with good health peace and nice sleep through out the nights, mother as u know mother how much alone we are due to my marriage issue my dad left me totally and restricted my mom not to keep contacts with me, mother since 7 years I am living far of my parents and home, mother I have no place in my parents home ,and we are very alone mother , my husband is a very typical person due to him I have no friends living far of everyone mother, due to my husband behaviour my sister also left me, mother please help me mother me and my child are alone in home , mother please soften my dad heart now and please reunite us with my parents and home now, mother please change my husband now let him realise what he did with me and my family, mother do miracle now and please let my husband mingle nicely with my sister and brother in law and mingle friendly with all of my friends , mother please I beg you with tears please mother help your child now I am totally depressed please mother come into my life now hold me heal me change me and strengthen me mother, mother with out my dad's acceptance I have no place in my parents home mother, please I beg you mother right now please do miracle now and please remind my dad about me and please let him forgive me and let him realise what he did against me and stop punishing me, mother please see send your angels and saints now and please speak to my dad now and please change him with your miracle and please let him accept Me my husband and my child now, mother I beg you please respond to my prayers now mother please answer to all my prayers now mother,mother please be with us always mother, mother please solve all my problems and tensions I am bearing now, mother I am totally depressed and disturbed mother please help me mother, mother due to severe stress and loneliness I am not feeling well mother, I am suffering from severe wheezing and sleeplessness and restless, mother please heal me , mother have mercy and heal me, mother do miracle and heal me , heal me totally whatever bothering me, and bless me with good heal peace and happiness forever , please, please answer to my prayers now mother,mother please restore my marriage and mother please restore all the broken relationship with my family, mother please reunite us with my parents and home now and bless me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your name mother amen. bangalore 2014-06-18
r kathu kollane mathave.koode undayirikkename mathave.please please please be with me amma nad help me with 349 and 509 results.please help me get an A grade in both of them.amma nanma varuthename.apathonnum varuthathe nokkename.amma i also pray for aaron that he may be healthy, happy and safe.thank you mathave for guarding him from all illnesses.mathave i pray for my tap i that i may do well and do a good job. sc 2014-06-18
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good growth and health.give me job amma.thankyou amma. varahapatnam 2014-06-18
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-06-18
henry mother mary today we should have many admissions and enquiries. thanks so much for yesterdays admission. kindly bless us. ave maria. amen. bangalore 2014-06-18
Ajoy Alex Dear Mother, Thank you Mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my parents and my sister,my relatives and friends,make them peaceful, free of all worries.Mother please bless for finding a job, which I am searching desperately and for good health. Mother please give my wife the strength who's carrying my kids to deliver healthy kids, please be with her always. Mathave karunayod prarthikukayanu....apeshikunnu... Bangalore 2014-06-18
Maria Doss Roche Victor Nandri Madhavee, Thanks for blessing my Entire family , Thanks for taking my Dad to heaven , Nandri Madhavee, Thanks for blessing my job , Amen Chennai 2014-06-18
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful,free us of all worries, help us in our job, helpus get a good house, good increment. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless us get agood full time maid. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happines mumbai 2014-06-18
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-18
J Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with godo health,good wealth,peace of mind and protect us from all evils,dangers and accidents and forgive our sins and forgive thsoe who sin aginst us.My saviour help me over coem all my problems and thank you for giving me another day ,bless this day with epace ,sucess and prosperity and give me confidecen and strenght to over coem all problems,issues and my professional problems ,give me strength to work hard and give the best out of me.Mother Mary i had attenede the interview but nothing as happened they are still looking for soem more candiates and i dont know wheter it did well or no,please this is an good offer and name of this compnay is very big and i can still grow in life and my career ,i can stay with my family ,mother mary please i beg if you can pls ge tme this job and increment is also very less its only 8 to 12percent and there is no promotion in this company,mother mary yes thsiw as vey good break for me and my career and my life but i need to grow in my life ,becaue i feel there is no more projects in future ,my saviour pelase gudie me and tell me what is wrong and what is bad for me,everythign i start in your name only please guide me adn help me get this job and this position is very senior it will help me grow further in life .Mother Mary in your name only i had attened this interview and i beg save me and there is no security inthis company ,anytime any thing can happen,i dotn want to get into such sitiuation in my life.My saviour help me over coema ll my problems and IPAD is another one which is haunting me i have done a mistake please save me my CEO will not keep quite he will throw me out of this company.My saviour show me way and i have committed to sahve my head if i get a good job and coem to your shrine,please my saviour without you i cant live on this earth,i need your blessing guidence and save this job till i get a better offer and protect me from all legal issues and problems and give me peace of mind ,strenght and my jewels of wife i need it please i coudl save some money to get it pls savemy wife's jewels so that i can ggive er back she had helped me in my problems days. Mother Mary in your name am startign my day please save me and protectme adn bless my realtionship with my CEO/my boss and my team members and give me strenght to work hard and bless me and to save my job,my name adn my dignity in this compnay and my realtionshipw ith my team memebrs adn bless me with godo leadership qualities so that adn forgive me for abusign and putting my team any team members down adn or any one else. Pls cleanse my body and soul so that am ready to be with you always. Mother Mary in your name am starting my day so please bless me with sucess peace and prosperity. Bless all my IT infra so taht everything goes well. O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, O Mary,virgin before childbirth keep me pure in soul and body, Everythreatening danger vanishes at thy prayer St.Anthony beloved of god and man pray for us. Amen, RGds, J.Dominic Vijay Kumar Dehradun 2014-06-18
carol Dear mother please bless my son help him to do well in his exams help him to get the job at harbour meritton help him to keep good health.bless my little baba jerad and jerom .help us all to keep good health .We trust in you dear mother. mumbai 2014-06-18
Shan Dear Mother, Beg your blessings for Good Health of my very beloved friend Maria and her kid Noah Good health, education and a bright Future. His school is reopening today and seek your blessings on him. Manila 2014-06-17
carol Dear mother, i ask of you in faith to please bless my son please help him to do well in his exams help him with the job at the Harbor Meritton please help him with good health.please bless y little Jerad and Jerom.Please keep us in good health. we trust in you dear mother for this. mumbai 2014-06-17
jennifer Dear Mother, Thank you mother very much for this ady and for all the favours granted. Mother please bless us blissful happy healthy marired life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good health, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mtoher please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mtoher please bless my family happiness n peaceful mumbai 2014-06-17
ashima martha james holy mother Velankanni i come to you with full faith . i was engaged and about to get married to my best friend who was in love with me from last 4 years . but all of sudden his mind was poisoned by his family . his family called off the wedding and he also broke the relationship with me . i have tried hard to convince him and mak him understand that this is a big misunderstanding but he was not even ready to talk on phone . he has hurt me alot and he and his family has said alot of bad things about me . i love him alot and i gave my 100% in this relationship. i pray to you to please make him realise of what wrong he has done and that abandoning me like this after the engagement was not right where i was ready to work on every problem with him. please punish people who have created this problem between us . they all have insulted me and my family and i pray to you that please make him regret and repent of what he has done. i still love him alot and still ready to give him a chance please give him strength to stand by me and for our love . i want to marry him and i pray to you to bless us both and make us a couple . please help me ,my dad and my sister as this is a very difficult time for us . i promise to bring mohit with me to Velankanni to offer our thanks and prayers together as a couple as soon as this miracle happens. New Delhi India 2014-06-17
ashima martha james holy mother Velankanni i come to you with full faith . i was engaged and about to get married to my best friend who was in love with me from last 4 years . but all of sudden his mind was poisoned by his family . his family called off the wedding and he also broke the relationship with me . i have tried hard to convince him and mak him understand that this is a big misunderstanding but he was not even ready to talk on phone . he has hurt me alot and he and his family has said alot of bad things about me . i love him alot and i gave my 100% in this relationship. i pray to you to please make him realise of what wrong he has done and that abandoning me like this after the engagement was not right where i was ready to work on every problem with him. please punish people who have created this problem between us . they all have insulted me and my family and i pray to you that please make him regret and repent of what he has done. i still love him alot and still ready to give him a chance please give him strength to stand by me and for our love . i want to marry him and i pray to you to bless us both and make us a couple . please help me ,my dad and my sister as this is a very difficult time for us . i promise to bring mohit with me to Velankanni to offer our thanks and prayers together as a couple as soon as this miracle happens. New Delhi India 2014-06-17
S Oh mother We thank you for all the blessings that you are showering on us. Today on my birthday, I thank you for all the blessing which you are showering on me.ma, bless me to celebrate many more birthdays with my husband and children. I surrender me, my husband and children before you. ma, protect us from all dangers and diseases. Bless us to lead a happy, healthy, prosperous, peaceful, long life together. Ma, I am so much worried about my small illness of pain and heart beat variations. Ma, protect me from all diseases and bless me with long healthy life so as to do my responsibilities of a wife, mother, daughter. I like to live long with my husband and my children. Bless ma, for this. I also surrender my anxieties about my elder son's studies, his character, my husband's business issues. Ma, help us to solve these problems properly and bless us to lead peaceful life. Ma, protect our parents. ma, bless our children to have good character in them. Ma, protect us from all dangers. Ma, bless me, my husband and my children with happy, healthy, prosperous, peaceful and long life. Abu dhabi 2014-06-17
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-06-17
Justin (Catholic) I am a very Senior citizen, very restricted and frugal in eating very minimum food. However, my stomach is unnecessarily Bulging without any reason. Please pray to Divine Mother to restore my stomach back to normal size and save me from ALL stomach problems. Kindly pray for me (Justin) for 30 days continuously so that Bulging of stomach is stopped and I have only a VERY Flat stomach. Thank you for your constant prayers in ALL your Masses and Offerings to Velankanni Matha. Justin(sufferer)pray to cure me &restore only a Flat stomach Chennai 2014-06-17
Renjith Philipose Dear Mother of Velankanny, With your grace and help through your son Jesus Christ bless me with all skills to successfully work to earn a house by the will of Jesus. Also kindly bless my sister to have her Australian PR visa ready and thereafter a good marriage proposal which she deserves for her bright and peaceful future as decided by Lord Jesus Geelong, Victoria 2014-06-17
ybis mother mary please pray for my wife .we both were married recently. we were in deep love good sexual life also.Lord as you time is up to have a control over her rude parents who try to destroy our relationship and father as you know after how long i recieved my partner .Dear amma please intercede in our life .no intimacy no sexual contact heart pricking pain.as you know amma well though im a sinner im not supposed to recieve such a treatment from my wife and her parents. i leaned on lord and amma for everything .Amma this humble child of lord is putdown before everyone .im now treated as a criminal..amma let im be bad in all as all claims .but father you know my innocence .so please give a chance to my wife to see my innocoene also within no time let her be changed in her character by yelling bad shouting on me like a mad .Her parents constanly put my wife and me in problems to harm our relation..dear lord dear amma please dont wait more to control them who try to seperate us .Lord Bless them . I had forgiven them. let amma my wife come back in previous life with love Amma Let my wife freed from problems by her parents and other relatives Let her overcontrolling parents and kith and kin shall be kept mum when planning to destroy our relationship amma please dont keep later amma ..Please intercede for me .. Amma bring my wifes mind from arrogant new generation thinkings Amma Let my wife be submissive to me and Loyal to my parents Amma Let her uncontrolled anger removed for ever Amma let her eyes get opened Amma make my wife simple ,down to earth in mind and dressing.Let she serve poor Amma please save her from her bad family Amma Let her visualise the joy in living with Lord bahrain 2014-06-17
ybis mother mary please pray for my wife .we both were married recently. we were in deep love good sexual life also.Lord as you time is up to have a control over her rude parents who try to destroy our relationship and father as you know after how long i recieved my partner .Dear amma please intercede in our life .no intimacy no sexual contact heart pricking pain.as you know amma well though im a sinner im not supposed to recieve such a treatment from my wife and her parents. i leaned on lord and amma for everything .Amma this humble child of lord is putdown before everyone .im now treated as a criminal..amma let im be bad in all as all claims .but father you know my innocence .so please give a chance to my wife to see my innocoene also within no time let her be changed in her character by yelling bad shouting on me like a mad .Her parents constanly put my wife and me in problems to harm our relation..dear lord dear amma please dont wait more to control them who try to seperate us .Lord Bless them . I had forgiven them. let amma my wife come back in previous life with love Amma Let my wife freed from problems by her parents and other relatives Let her overcontrolling parents and kith and kin shall be kept mum when planning to destroy our relationship amma please dont keep later amma ..Please intercede for me .. Amma bring my wifes mind from arrogant new generation thinkings Amma Let my wife be submissive to me and Loyal to my parents Amma Let her uncontrolled anger removed for ever Amma let her eyes get opened Amma make my wife simple ,down to earth in mind and dressing.Let she serve poor Amma please save her from her bad family Amma Let her visualise the joy in living with Lord bahrain 2014-06-17
liza my dearest mother... pls be with me... pls help me mother... i want my friend back...pls help my friend to analyse the situation... pls shower your blessings on me mother.. KLMSR 2014-06-17
Viviana dsouza mogal maie argam ditanv tuka soglea tujea denea passot maie sirachea toklan ghal amkam salry dilea puro mhunn ani maie amchea agram hea disani soglea vostu mota maie hea velar amchea financial situation sarkea nam maie tum amkam pav amkam bhori bholaikiean dovor mhunn magtanv. maie. india 2014-06-17
kavitha henry Amma what I should write I dono I have money pecom pls take and give all my golds from the shop amma do me this help amma.amma pls help I have health problems also amma pls keep me slim amma I should not become fat amma first I am applying your oil on my stomach amma.my stomach should go inside amma its looking very bad amma pls pray for me amma.My daughter should read nicely and she have to come first amma and bless my son also amma he should be very like my daughter amma every thing he have to fast amma and he should come good colour amma.both my son and daughter should be good colour like you only amma.before December I should get a good job amma without any certifacite I should get the job amma with good salary amma on Saturday I should get half day or holiday amma bless me for the money to get all my golds from the shop amma pls only I have your help amma.without you I don't have any one help amma in my family and his family also amma.even I should build the house like vasantha amma she have so much of blessing amma from you. Even you bless me amma I should build a house in my own business money amma I don't want from aNY one amma only I need your help amma so many things you have given to me amma help me in the money matter and in the business amma amen. bangalore 2014-06-17
harrish pls maaa give hostel to me and my frnds......pls help me.....pls chennai 2014-06-17
rupa Dear Mother I have come to seek your protection and blessing for my mother who will be getting her tests done tomorrow. Please bless that all her reports come normal and she is in her best of health specially her kidney. You had granted me this favour sometime back yet again I come to thee with the same request. Please help and be with her tomorrow when she goes for her tests. Mah 2014-06-17
r thank you amma for taking care of aaron.please continue to be with him and keep him healthy, happy and safe.amma i pray for my 349 and 509 that I get an a grade in both.please be with me amma and bless me amma.amma i pray for my midterm today that I get all questions right and score full marks.kathu kollane mathave.koode undayirikkename.apathonnum varuthathe nokkename. sc 2014-06-17
SM Please pray that SMV really loves me and that Li and Man stops troubling us, that lias papers come today so that she can leave. Please pray that Liya calls me home and all is well and the filing is done as planned and the house sale is smooth and easy. Please change Li and Man to be good to us and not fight and the RS has a safe travel and good trip. M 2014-06-17
JS Our lady of velaankani, I come to you today with humble heart to request to pray for my son and daughter to Almighty God. Through your intercession they may obtain God's forgivenes and blessings. They have come to an age of marriage but they need God's mercy to find suitabel spouse. Please pray for them and give them a God fearing, good mannered and healthy spouse. Our loving mother, mother of God you have never let us down and I am certain that you will hear my prayer and petition and grant my request. Amen Australia 2014-06-17
mahesh Dear amma lease bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-17
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-17
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…… Bangalore 2014-06-17
henry mother mary please bless us to improve our driving school.the admissions should get full.we should have many admissions and all enquiries should get converted. the nearby unauthorised driving school should get closed.we should get all our outstanding debts to be cleared.we should take out all the jewelleries we are pledged for this business.mother mary please help us to sort out all the problems. kindly bless us. bangalore 2014-06-17
Maria Doss Roche Victor Nandri Madhavee, Thanks for giving us the Holy Spirit , Thanks for blessing my Family , Thanks for guarding our house all the time . Thanks for blessing my job Amen Chennai 2014-06-17
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health,make him peaceful and normal child, Mother please bless avi n me good health,make us peaceful, free us of all worries, help us in our job, help usget a good house, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless avi n me of good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother pleas ebless us get a good full time maid. Mother please bless my family peace n happiness. mumbai 2014-06-17
rej ma, thanks a lot for everything. My husband worked hard for 6 years and last week he was told to leave the job,Please bless him with good job. Pune 2014-06-17
carol Dear mother, please bless my son help him to do well in his exam help him with confidence and good health. Please help him to get the job at the harbour meritton .please bless my little jerad and jerom with good health..Please help us with good health. mumbai 2014-06-17
siby prayer for my innocence amma pls help bahrain 2014-06-16
JOHNSON MATHEW Mathave Enikku Nalla orru Job offer kittiyathinayyi Nanni Paraunnu..ella Kaaryangalum nalla reethiyil nadannu visa Prosces cheyythu joliyil praveshippan edayakaname..athodoppam enieum ente pappa,mummy,anishchan,remiya chechieum kunjineium thirumunppil samarpikunnu.aapathil ninnum anarthangalil ninnum rogathil ninnum viduvichu kaathukolaname..amen UAE 2014-06-16
carol Dear mother please bless my son as he is starting his exams from today,help him to do well help him to keep good health .please help him to get a job at the Harbour Maritton.Help him to be responsible.let your love be apone him dear mother. mumbai 2014-06-16
lavi Mother Mary please help me for my leave. uae 2014-06-16
Ashok Dear Matha, This is the 1st I am requesting you. Change my financial status. Help me to buy a own house. chennai 2014-06-16
Anon Blessed Mother Mary, ever virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-06-16
Krd Maa seema job ki problem emi lekunda , rakunda chudandi thalli. Subbu job vishayamlo lo sahayam cheyyandi thalli. Book chesina flat cancel cheyyala Vadda annadi meere maaku cheppali amma. Anni savyam ga jarigela chudandi amma. Maa kosam Prardhana cheyyandi thalli. Meeku maa kruthagnatha sthutulu maa. India 2014-06-16
jomole Amma, Please be with us and bless us as we are travelling. dubai 2014-06-16
2014-06-16
doss mathavee en magal evanchilinku virus fever unnaiyee nambi irukum en magalai achivathiyum magaluku ulla annaithu viyathigalaiyum neekidum thayee engaluka vendikollum arockia mathavee kuwait 2014-06-16
JINU PHILIP PARISHUDHA MATHAVEE AMEE ADIYARKAI APPESHICKKANNAMME AMEE ADIYANNUM BROTHERINNUM NALLA ORU JEEVITTHAVUM JOLLIYUM FUTUERUM KITTUVANNUM MATHAVINNU AAYUSSUM AAROGYAVUM KITTUVANNUM BHAVANATHILLE KASHTTATHAKAL MARIKITTUVANNUM AMEE VELANNKANNI AMEE ADIYAARKAI PRATHICKKANNAMMEE U A E 2014-06-16
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless prawn pond give them good health and growth.bless kanna for schooling.give me job amma.thankyouamma. varahapatnam 2014-06-16
Brinson My Dear Mother, please pray for my Father whose health is too week. By the precious blood of our Lord Almighty Christ Jesus let all his body function normally. Thank You. Florida 2014-06-16
r kathu kollane mathave.koode undayirikkename.tank you so much for your love and kindness amma.i pray that i get an a grade in 349 and 509. i pray that aaron be happy, healthy and safe when he goes to school today. i pray for my exam tomorrow that i may do very well.kathu kollane mathave.nanma varuthename amme. sc 2014-06-16
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-16
rmg Dear Mother My kids will be gettng their 2nd term report for their excam. Pls help that they do well and have good position in their class. Pls help them mother.Keep them in good health. Malaya 2014-06-16
Suresh Thanks Amma for your prayers Bangalore 2014-06-16
Shilpa oh my lord, ennode prayer kekkename. na senja thappella eppo enaku theriyithu athukku na rombha kastapettitirukku. matha eppome enne nee kayvittathilai vere ethume vena matha ennode praveen joseph ennode ella thappum marandu ennode life kku thirumbi varaname. enime enda life fulla avane happya avanode family, ennode family ve happya veppen. ennode ella past thappukalum marandu mannichu enakku ennode praveene thareename. ella problems um mudinju nanga 2perum velankanni varuven. am Sory i dont knw tamil aswel. ethavathu thappirunda mannikkanum. na trust pandrein mathave. KERALA 2014-06-16
lavi Hail, holy Queen, Mother of mercy, hail, our life, our sweetness and our hope. To thee do we cry, poor banished children of Eve: to thee do we send up our sighs, mourning and weeping in this vale of tears. Turn then, most gracious Advocate, thine eyes of mercy toward us, and after this our exile, show unto us the blessed fruit of thy womb, Jesus, O merciful, O loving, O sweet Virgin Mary! Amen. uae 2014-06-16
kavitha henry Mother mary amma pls bless me and have mercy on me amma Pls improve my business only for our life that business only amma give us more admission amma I have lot of money problem amma pls solve all the problems soon amma Evey day my interest is going up amma pls do me some thing amma bless me amma the business happen nicely amma pray for me with Jesus Christ and bless me. bangalore 2014-06-16
kavitha henry Amma what I should write I dono I have money pecom pls take and give all my golds from the shop amma do me this help amma.amma pls help I have health problems also amma pls keep me slim amma I should not become fat amma first I am applying your oil on my stomach amma.my stomach should go inside amma its looking very bad amma pls pray for me amma.My daughter should read nicely and she have to come first amma and bless my son also amma he should be very like my daughter amma every thing he have to fast amma and he should come good colour amma.both my son and daughter should be good colour like you only amma.before December I should get a good job amma without any certifacite I should get the job amma with good salary amma on Saturday I should get half day or holiday amma bless me for the money to get all my golds from the shop amma pls only I have your help amma.without you I don't have any one help amma in my family and his family also amma.even I should build the house like vasantha amma she have so much of blessing amma from you. Even you bless me amma I should build a house in my own business money amma I don't want from aNY one amma only I need your help amma so many things you have given to me amma help me in the money matter and in the business amma amen. bangalore 2014-06-16
mb Thanyou mother Merry for what you have given in my life. Today I want to ask you for my sister, my sister and my brother in la have no job, no house and suffering with bad health. please I join my hands and bow my head in front of you to take care of their lives in your hands. They are your children and you don't let your children suffer. My sister son is apperaring for 12 th exams also please bless him and give him a job so he can help his family. I love you and thank you for everything. delhi 2014-06-15
Kumaresan Pls pray for my wife and son who met an car accident ,they will be get well soon ,pls pray for this . My wife name is saranya and my son name is Mitun kartikeyan .my wife is pregnant ,pls pray for the new coming. Singapore 2014-06-15
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-06-15
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma yesterday I said my 6th last week novena, ma during the novena I placed my petition please hear my prayer ma.Thank you ma. Auh 2014-06-15
SM Please pray that Li and man become loving and quiet, that her papers come this week so that she can leave urgently and to make smv more loving, confident and comfortable and that the fil is done immediately, please pray that Ren travels safely and has a very happy trip, for hmath to eat well and be happy and for mm to have good health and her son to get a good job urgently. Also for Susan and childrens good health and happiness and to get a new house. M 2014-06-15
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless kanna for schooling.bless prawn pond give them good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-15
Maria Doss Roche Victor Thanks Mother Mary , Thanks for blessing my family and team, Thanks for guarding us all the time , Thanks for traveling with us all the time , Thanks for taking My Dad to heaven with you , Thanks for forgiving all our sins, Thanks for giving us the courage to fight the evil, Thanks for giving us the holy spirit . Amen Chennai 2014-06-15
Stephen c Dear People of God, Please pray to Jesus and Mother Mai to bless all my work for this week without any interference from any departments. Thank you Jesus Praise you Jesus love you Jesus- servant of Jesus -Stephen Mumbai 2014-06-15
G V DEAR MOTHER OF GOOD AND MIRACLES PLEASE HAVE MERCY ON US AND FORGIVE ALL OUR SINS AND BLESS AND HELP US IN ALL OUR WORKS AND MAKE THEM SUCESSFUL MAA WE ALL THANK YOU FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THAN THE LAST MONTH MAA PLEASE HELP US IN ALL OUR DAILY NEEDS AND PROTECT US FROM ALL THE EVILS SPIRITS AND BE WITH US ALWAYS MAA HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyderabad 2014-06-15
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy and healthy married life. Mother please bless avi n me good health, make us peaceful, free us of worries n tension, good house, good increment godo promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless us get agood full time maid> Mother please free avi n me of all worries n tension. Mother bless bless my family peace n happiness mumbai 2014-06-15
Suresh Thanks Amma for your prayers Bangalore 2014-06-15
Nandini Velankanni Amma, Please protect me and my husband, Kishen, and our wedding. Hold us in a beautiful life and relationship. Dont let those that are trying to seperate us succeed in their endeavour. Undo all the wrong doings these people may have made or trying to do. Never let them come between us. Please unite me with my husband again. I am ready to do compromises but he should be loving with me as well and treat me with respect and provide for us and protect me. Maa, I just want a happy life with my husband, in our home. Please do not let my wedding break up. Mauritius 2014-06-15
Wilma Dear Mother,You know how much I am stressed.I am going to my assessment and you know how difficult was it to get approval for my selection.Please be with me during my assessment please give me courage to face my assessment held on Monday. Dubai 2014-06-14
mahesh Dear amma please bless my family.give good health to vijaya kanna amma rishika nanna.bless prawn pond give them good health and growth.give me job amma.thankyou amma. varahapatnam 2014-06-14
kavitha henry Amma pls have mercy on me amma help in every thing amma I got delivery on may 1st amma my stomach should go I side and I should be slim amma I should not become to fat amma I am having a thyroid problem amma I should look good aand I should not have any pimple in face amma and today in the office at lease one admission should happen amma Pls bless me and help me in money amma. bangalore 2014-06-14
Archan Swetha MARYMATHA STOTRAM MOTHER VAILANKANNI,BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. BLESS ME WITH AERONAUTICAL ENGG. AND GOOD HUSBAND. ONE TIME VISIT TO VELANKANNI. TIRUCHANOOR,TIRUPATI RURAL 2014-06-14
Archan Swetha MARYMATHA STOTRAM I WANT TO STAY ONLY 2 YEARS IN BANGALORE,I WANTED EVEN MY POSTING IN CHENNAI ONLY.I DON'T WANT TO SEND ANOTHER PRAYER REQUEST REGARDING THIS. I DON'T KNOW WHAT YOU DO,BUT I WANT TO LIVE IN CHENNAI. I WANT MY OWN HOUSE,EDUCATION FOR CHILDREN.EVERYTHING IS BEST IN MY EYES IN CHENNAI. TIRUCHANOOR,TIRUPATI RURAL 2014-06-14
Beyline Mama Mary ,this monday will be my doctoral commitee for registration to PhD.Mama be with me for the presentation and interview when they ask questions.Mama give me strength to prepare well and mama my first semester examination results came .But Mama my marks are average mama as i am awaiting for second semester results mama please tell jesus to give me good marks with a GPA of 7 and above for my final exam.Mama pray for me always.Thank you Jesus,Praise you Jesus. kollam 2014-06-14
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, help us in our job,help us get agood house, good increment, good promotion. Mother please bless us sort our family dispute. Mother pleease bless us get agood full time maid. Mother please bless my dad eternal peace. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness. mumbai 2014-06-14
Alphy Amme ninaku orayiram nanni parayunnu,amme njan ethra divasamayi ninnodu pray cheyuva,ente room nu oru aaline kondutharan rent nu ,amme nee eniku vegam aline kanichu tarane,amme brokerage ellathe familykare eniku kittane,amme ente pray kelkane,ente avashyam nee sadichu tarane,amme vegam thanne eniku cash um kittane,karthikinte cash kodukan sadikane,amme enne kathukollane,ente apeksha upekshikaruthe,amme nalla familykare nee kondutharane,amme naleyum kittiyilla enkil othiri budhimutta amme,ente kanninu nee kanichu tarane, Mumbai 2014-06-14
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones and me. Amen. --- 2014-06-14
kavitha henry Amma mother Mary pls have mercy on me amma pls I should get one good job soon amma and I should solve all my problem soon ammaonly interest I should pay in one gold shop as on this month 50 thou and amma pls help me that I should get a job in kormangala Saturday holiday or half day amma pls bless me soon I should get a good job amma if I get a good jon without certificate. bangalore 2014-06-14
Alphy Amme orayiram nanni parayunnu amme,ente makale kathukollane amme avarku 16 nu school thurakuva amme avarku nannayi padikan sadikane ,amme ente milankuttante madi oke matti kodukane,amme makalku nallathu paranjukodukan sadikane,amme ellavarkum nanma varuthane,amme ente ella asugavum matti tarane,amme ente life il samadanam tarane,nannayi chindikanum pravarthikanum sadikane,amen Mumbai 2014-06-14
Shirley Mother Mary I was born to my parents in fulfillment of a vow made to you. I thank you for the endless mercy and grace you have poured over me. I do apologies for being negligent in venerating you when promised. Mother, you are the Mother of all Mothers and most forgiving. Take away all the punishment from my life and bless me and intercede for me to God the FAther, God the Son and God the Holy Spirit to fullfill my wish on which I will begin work very soon. Mother bless this work with success. Uk 2014-06-14
sakthivelchinnadurai Amma unkaluku nandri sola varthigal ilai amma. Akka ku nalapadiga judgement tandu irukenga, Nermaiana judge Fast track III court judge S. Senthil kumaresan XVII th court judge appoint pani tandu irukenga kodana kodi nanrigal amma. Amma five yr aga poradinaoru neyathuku nala theerpu tandeergal amma. Marupadium PP Maran sathan pole cross panavendum petition potu ular amma. Sathan ai neenga dane amma veriati adikanum. Netru Satan PP Maran court ku varavidamal taduthu niruthi irukenga amma ungaluidaa arputham varthi inal sola mudiathu amma. Amma Nala judge honest judge tandeer amma nandri amma. Amma marupadium anda satan saium pava sailgali irundu neerdane vidutalai pananum amma. Amma Cross ilamal order copy neenga dane unga magan yesuvidam manradi vangi taranum amma. apadi cross panuvadaga irundalum Anda Dr. Neenga dane marupadium varavaikanum amma anda arputham neenga dane amma sainum. Amma vendum ynru PP Maran panathirkaga varavidamal taduthu niruthukirar. Avr taduthalum ynga amma ynidam varungal kelungal kodukapadum , tatungal tirakapadum soneergal amma. Um magan yesuvidam mandraidi akka ku vetripathil nala oru theerpin order copy ai neer anupum amma. Amma s. Senthil kumaresan Judge ayya vai ynga akka case order copy varum varai ynkaium transfer panamal inkia vaithu irukum padi ketukolkirene. Judge ayya ku netru udmbu sari ilai amma neerdane kunapaduthineer amma. Adrkum nandri amma. Akka Advocate manathilum, gunathilum, nermailum ulagathil uyrnda manidar, anda manidar ADV sankarasubbu Billion andugal vayavendum ynru umidam manradukirene amma. Amma Uyndra mandiar viravil judge aga neer dane asirvadam taravendum amma yaligalin uyir ai kaprtum arupuda manidar amma.Avr magan case Sthishkumar case il kuda viravil neyam kidikanum amma. Appavigalai neerdane velila yadukanum amma. Amma un magan yesuvidam tan saium pavam ynavendru theriaml saium PP Maran, Cort constable Rajathi, si logamball, anaivarium neerdane manikavendum amma. PP Maran tirunda vendum amma panam ynru vendum ynralum sambidikalam, nermai ilada manidan vayndalum avn oru iranda manidanil oruvanga karudapaduvane. Nargam ynral yna venru therila amma. Amma avnga tanda date maranum anivarukum varum thedi ai matri tani thedi neerdane amma um magan yesuvidam vangi tarnum. yn sagothiri inimel yaru mugathilum mulika kudathu. Police karangal pana chinna pavam yn akkavai pole yathnio appavigal padika pattu irukanga amma. Amma ynadane petition potalum anda petition panathukaga podum petition aduthavanga kita panam vangi avnga vairu erinju vangi sapidum panathuku neerdane amma tandanai taravendum amma. Amma ponu irundu irundal arumai therium amma, Rendum pain amma , Anda pain ivenga parents panum pavathuku paingaluku tandanai tarakudathu amma. Amma Netru epadi taduthu niruthi irukingalao adupola PP Maran Transfer panividunga amma, Court constable rajathi aim matrividunga amma, police m , PP maran vilaiadum vilatu inru udn nirutanga amma panamum vangaikondu thuroga sailil edupadum PP Maran ai viravil pani idai matram panavam amma. Amma unga arputham netru therinjudu amma. Ynga akka vai inimel ipadi oru atkal mugathil vilamal neerdane kaptrnum amma. Amma Veliatru veliatru PP Maran im Police constable Rajathi ai Veliatru amma. Amma tangal podum kaki dress kaptra alla appavigalai saga adikdane amma Virvil veliyatru amma. Amma ARpudangal saipavar andavar um magan amma. Amma aka ku ordercopy udndiaga nermaina judge idm irundu june19 neenga dane amma vangi tarnum Amma unga aduthua aruputham nadakum amma. Thans amma chennai 2014-06-14
sakthivelchinnadurai Amma unkaluku nandri sola varthigal ilai amma. Akka ku nalapadiga judgement tandu irukenga, Nermaiana judge Fast track III court judge S. Senthil kumaresan XVII th court judge appoint pani tandu irukenga kodana kodi nanrigal amma. Amma five yr aga poradinaoru neyathuku nala theerpu tandeergal amma. Marupadium PP Maran sathan pole cross panavendum petition potu ular amma. Sathan ai neenga dane amma veriati adikanum. Netru Satan PP Maran court ku varavidamal taduthu niruthi irukenga amma ungaluidaa arputham varthi inal sola mudiathu amma. Amma Nala judge honest judge tandeer amma nandri amma. Amma marupadium anda satan saium pava sailgali irundu neerdane vidutalai pananum amma. Amma Cross ilamal order copy neenga dane unga magan yesuvidam manradi vangi taranum amma. apadi cross panuvadaga irundalum Anda Dr. Neenga dane marupadium varavaikanum amma anda arputham neenga dane amma sainum. Amma vendum ynru PP Maran panathirkaga varavidamal taduthu niruthukirar. Avr taduthalum ynga amma ynidam varungal kelungal kodukapadum , tatungal tirakapadum soneergal amma. Um magan yesuvidam mandraidi akka ku vetripathil nala oru theerpin order copy ai neer anupum amma. Amma s. Senthil kumaresan Judge ayya vai ynga akka case order copy varum varai ynkaium transfer panamal inkia vaithu irukum padi ketukolkirene. Judge ayya ku netru udmbu sari ilai amma neerdane kunapaduthineer amma. Adrkum nandri amma. Akka Advocate manathilum, gunathilum, nermailum ulagathil uyrnda manidar, anda manidar ADV sankarasubbu Billion andugal vayavendum ynru umidam manradukirene amma. Amma Uyndra mandiar viravil judge aga neer dane asirvadam taravendum amma yaligalin uyir ai kaprtum arupuda manidar amma.Avr magan case Sthishkumar case il kuda viravil neyam kidikanum amma. Appavigalai neerdane velila yadukanum amma. Amma un magan yesuvidam tan saium pavam ynavendru theriaml saium PP Maran, Cort constable Rajathi, si logamball, anaivarium neerdane manikavendum amma. PP Maran tirunda vendum amma panam ynru vendum ynralum sambidikalam, nermai ilada manidan vayndalum avn oru iranda manidanil oruvanga karudapaduvane. Nargam ynral yna venru therila amma. Amma avnga tanda date maranum anivarukum varum thedi ai matri tani thedi neerdane amma um magan yesuvidam vangi tarnum. yn sagothiri inimel yaru mugathilum mulika kudathu. Police karangal pana chinna pavam yn akkavai pole yathnio appavigal padika pattu irukanga amma. Amma ynadane petition potalum anda petition panathukaga podum petition aduthavanga kita panam vangi avnga vairu erinju vangi sapidum panathuku neerdane amma tandanai taravendum amma. Amma ponu irundu irundal arumai therium amma, Rendum pain amma , Anda pain ivenga parents panum pavathuku paingaluku tandanai tarakudathu amma. Amma Netru epadi taduthu niruthi irukingalao adupola PP Maran Transfer panividunga amma, Court constable rajathi aim matrividunga amma, police m , PP maran vilaiadum vilatu inru udn nirutanga amma panamum vangaikondu thuroga sailil edupadum PP Maran ai viravil pani idai matram panavam amma. Amma unga arputham netru therinjudu amma. Ynga akka vai inimel ipadi oru atkal mugathil vilamal neerdane kaptrnum amma. Amma Veliatru veliatru PP Maran im Police constable Rajathi ai Veliatru amma. Amma tangal podum kaki dress kaptra alla appavigalai saga adikdane amma Virvil veliyatru amma. Amma ARpudangal saipavar andavar um magan amma. Amma aka ku ordercopy udndiaga nermaina judge idm irundu june19 neenga dane amma vangi tarnum Amma unga aduthua aruputham nadakum amma. Thans amma chennai 2014-06-14
sakthivelchinnadurai Amma unkaluku nandri sola varthigal ilai amma. Akka ku nalapadiga judgement tandu irukenga, Nermaiana judge Fast track III court judge S. Senthil kumaresan XVII th court judge appoint pani tandu irukenga kodana kodi nanrigal amma. Amma five yr aga poradinaoru neyathuku nala theerpu tandeergal amma. Marupadium PP Maran sathan pole cross panavendum petition potu ular amma. Sathan ai neenga dane amma veriati adikanum. Netru Satan PP Maran court ku varavidamal taduthu niruthi irukenga amma ungaluidaa arputham varthi inal sola mudiathu amma. Amma Nala judge honest judge tandeer amma nandri amma. Amma marupadium anda satan saium pava sailgali irundu neerdane vidutalai pananum amma. Amma Cross ilamal order copy neenga dane unga magan yesuvidam manradi vangi taranum amma. apadi cross panuvadaga irundalum Anda Dr. Neenga dane marupadium varavaikanum amma anda arputham neenga dane amma sainum. Amma vendum ynru PP Maran panathirkaga varavidamal taduthu niruthukirar. Avr taduthalum ynga amma ynidam varungal kelungal kodukapadum , tatungal tirakapadum soneergal amma. Um magan yesuvidam mandraidi akka ku vetripathil nala oru theerpin order copy ai neer anupum amma. Amma s. Senthil kumaresan Judge ayya vai ynga akka case order copy varum varai ynkaium transfer panamal inkia vaithu irukum padi ketukolkirene. Judge ayya ku netru udmbu sari ilai amma neerdane kunapaduthineer amma. Adrkum nandri amma. Akka Advocate manathilum, gunathilum, nermailum ulagathil uyrnda manidar, anda manidar ADV sankarasubbu Billion andugal vayavendum ynru umidam manradukirene amma. Amma Uyndra mandiar viravil judge aga neer dane asirvadam taravendum amma yaligalin uyir ai kaprtum arupuda manidar amma.Avr magan case Sthishkumar case il kuda viravil neyam kidikanum amma. Appavigalai neerdane velila yadukanum amma. Amma un magan yesuvidam tan saium pavam ynavendru theriaml saium PP Maran, Cort constable Rajathi, si logamball, anaivarium neerdane manikavendum amma. PP Maran tirunda vendum amma panam ynru vendum ynralum sambidikalam, nermai ilada manidan vayndalum avn oru iranda manidanil oruvanga karudapaduvane. Nargam ynral yna venru therila amma. Amma avnga tanda date maranum anivarukum varum thedi ai matri tani thedi neerdane amma um magan yesuvidam vangi tarnum. yn sagothiri inimel yaru mugathilum mulika kudathu. Police kara