Home About  Velankanni Location Map Church Timings
Apparitions of Mother Mary
Life of Mother Mary Prayers
                         Prayer Request to Our Lady of Good Health
History
About Church
Photo Gallery
Personal Experience
Testimonies
Prayer Request
Guest Book
 

 

 

 

 

 

 

 

 

 "If you can believe, all things are possible to him who believeth. Mark 9:23 "... Hence do not worry, the Lord God will surely hear our prayers through the intercession of Mother Mary..

SUBMIT YOUR  PRAYER REQUEST HERE

 

NamePrayerPlaceDate
jis for coceiving a baby abudhabi 2015-05-24
G V DEAR MOTHER HAVE MERCY ON US AND FORGIVE ALL MY SINS AND HELP ME IN ALL MY NEEDS AND WORKS AND PROTECT US FROM ALL EVIL SPIRITS AND HEAL FROM ALL OUR SICKNESS IN JESUS NAME I PRAY AMEN Hyd 2015-05-24
jennifer Our lady [my mother you have been always with me and my family....... please continue to protect us with peace in the family............thank u my mother...I wish you can appear to me so that I can see u...... chennai 2015-05-23
SASI KUMAR KRISHNA LORD MARY MOTHER ON MONDAY 25TH MAY 15 MY YOUNGER SISTER IS TRAVELLING TO JAMMU WITH HER INFANT. PLZ I PRAY BLESS THEM, LET THEY HAVE GOOD JOUNRNEY. AMEN PRAISE THE LORD. SECUNDERABAD 2015-05-23
SASI KUMAR KRISHNA AMMA MADHA I`M SEEKING FOR GOOD LIFE PARTNER. WHO SHOULD UNDERSTAND ME IN LIFE. PLZ HELP ME MADHA. AMEN. KUMARSHASHI_99@YAHOO.CO.IN SECUNDERABAD 2015-05-23
Caroline malah Dear velangkanni maatha pls pray for my family. My name is Caroline Malah.my husband's name is Victor. I'm Subang jaya,Malaysia. I hv 2 children Vanessa mathumita and Elvin athittean.past 3 year's we are suffering with many problems.a lady called julliet eugine from our same bec group trying to ruin my marriage life n trying to attract my husband using black magic power.my husband believe her n her family. She is married with 2 kids.almost everyday she calls n disturbing my husband.n try to control him.because of jealousy my husband lost his job 3 times n just got new job 1 month ago.pls MA pray to Jesus n deliver my husband from wicked lady n from all suffering.save my marriage and family from evl n black magic.may god bless my family. Tq. Malaysia 2015-05-23
Caroline malah Dear velangkanni maatha pls pray for my family. My name is Caroline Malah.my husband's name is Victor. I'm Subang jaya,Malaysia. I hv 2 children Vanessa mathumita and Elvin athittean.past 3 year's we are suffering with many problems.a lady called julliet eugine from our same bec group trying to ruin my marriage life n trying to attract my husband using black magic power.my husband believe her n her family. She is married with 2 kids.almost everyday she calls n disturbing my husband.n try to control him.because of jealousy my husband lost his job 3 times n just got new job 1 month ago.pls MA pray to Jesus n deliver my husband from wicked lady n from all suffering.save my marriage and family from evl n black magic.may god bless my family. Tq. Malaysia 2015-05-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-23
Jaya john Mother please take care of my husbands health and also his future be with him always and bless him in all the walks of his life. Help him in his job, all kinds of problems he has to face regarding his job and health and family. Please mother be with him always and take care of him. Please be relieve him and tAke away from him all his problems and bad omens that was caused by his mother and her relatives. Please let him not suffer due to his mothers family's bad deeds and bad things that they have done. Please take care of our two daughters and keep them also in your hands and bless them and relieve them from the problems of their fathers family's bad deeds and please make their life safe and secure and happy . Be with us mother and help us please . Amen Kalyan 2015-05-23
Arul Ajit Kumar Dear Mother Mary Firstly, we remain grateful for sparing my family from all dangers till now. I am part of a family which has been struggling so long financially, seeing all our efforts turning futile. I curse myself and my luck every day that I am not able to give rest to my parents who are aged above 50, create a peaceful life to them even though I am an MBA Graduate,employed. I am making this prayer to beloved mother to continually shower her blessings upon my family as she is always and help me to settle in a job I am seeking for so long in a good organization. We as always repose our faith in you and believe our hard times are nearing to be over. I request all of you to join me in my prayer. Chennai 2015-05-23
RIFFIN RAPHAEL P MY NAME IS RIFFIN I AM POST THIS LETTER FOR ASKING IN YOUR PRAYER. NOW I AM IN QATAR MY GOD MAKE A OPPORTUNITY IN BANK ,I CAN FINISH THE EXAM AND INTERVIEW WITH GOOD SCORE,NOW MY APPLICATION SEND TO GOVT OF QATAR .PLEAS PRAY FOR; THEY ARE NOT MAKE OBJECTION , AGAINST MY APPOINTMENT IN BANK DOHA QATAR 2015-05-23
RIFFIN RAPHAEL P MY NAME IS RIFFIN I AM POST THIS LETTER FOR ASKING IN YOUR PRAYER. NOW I AM IN QATAR MY GOD MAKE A OPPORTUNITY IN BANK ,I CAN FINISH THE EXAM AND INTERVIEW WITH GOOD SCORE,NOW MY APPLICATION SEND TO GOVT OF QATAR .PLEAS PRAY FOR; THEY ARE NOT MAKE OBJECTION , AGAINST MY APPOINTMENT IN BANK DOHA QATAR 2015-05-23
m Dear holy mother.my father has been suffering from witchcrafts, black magic,demonic oppression since 9 months.a lambadi lady had done black magic for 3 times,firstly to become mad man,secondly to get heart attack ,thirdly to kill him and see his dead body.amma we have no word's to speak.. We have only tears left behind with us.that lady is doing black magic to my dad for every amavasya repeatedly she is doing with a group of members, giving money to those people..she is full of anger,showng strong annoyance,caustic,enraged at my dad..his health was totally spoiled... Suffering from severe gastric indigestion, gastric problem, vomitings,doctors told surgery should be done for gallstones and prostate gland problem. Amma heal my father so that no surgery is done..frequently urinating,sleeplessness... Amma also give relieve from his office to new place by next Saturday.higher officials d.g.m is stopping my father for not getting relieved.. Thnq mahboobnagar 2015-05-23
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatunna ella budhimuttukalum vishamagalum maati saukyam tharaname...Athodoppam enneium ente pappa,mummy,anishchan,remiya checheium ashima moleum thirumunppil samarpikunnu aaapathil ninnum anarthagalil ninnum rogathil ninnum viduvichu kaathukolaname...Amen Dubai 2015-05-23
Muthu Rajendran amma nee thaan en kulanthaikalukku atharavai pathukappai irukka vendum thaye shosthirem chennai 2015-05-23
n amma intercede for me unite me and shobu in marriage please amma and moh/dha i clear in my first attempt and securea good job there and his parents agree for early marriage karntaka 2015-05-23
Sanjna oh holy mother of good health kindly bless and heal my mother's illness I trust in you. Bangalore 2015-05-23
Mary Ammae pls pray fr me ma results wll be out tommoeow plss forgive ma sins whtever i did to ma fd bcz it hurted me so mch .... ammae pls pray fr me and plss understnd me Ammae ... kerala 2015-05-23
r Thank you so much for your love and kindness amma. Thank you so much for your grace. Thank you so much for being with me and helping me with everything. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamre, kanyattunirappu muthappanmare, st antony appacha, st jude appacha please please please be with me and help me with everything that I do. Mathave, please be with me and help me with everything. I surrender my hfouread and work visa nd job in your hands amma. Please help me get it on time amma. Kathu kollane amme. Koode undayirikkename amme. slo 2015-05-23
Sheeba Dear Mother Mary, I pray for the cure of my mother who is ailing since the past few months. I am extremely sorry I could not fulfil my promise of coming to your shrine after she was cured last time. I will come to Velankkani soon. Please dont let my mother suffer. Mumbai 2015-05-22
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-22
alvin bless us through my mother mary for get a comfortable situation in court tomarrow on 23.05.15 and get the bail easily from court for me and my mother for the cheque case kottayam 2015-05-22
m Dear holy mother.. Amma my father has been suffering from witchcrafts, black magic,demonic assignments,evil eye since 9 months.a lambadi lady had done black magic to my father for 3 times to kill him by any means joined with a group of members .their aim is to kill my father by any means...hence he is suffering from a number of diseases and thereby fallen sick.he is suffering from gastric indigestion, severe gastric problem, gall stones problem, prostate gland problem, aayasam,not sleeping during nights ,..amma pls heal my father, touch him and give ur deliverance. Amma pls save my father, protect my fathers life...banish from him all forces of evil,black magic,demonic oppression..thanking you mahboobnagar 2015-05-22
raja Amma marry ma, feeling very sad I'm very truthful to my lover now she in big confuse her sister is not give permission to marriage... We r waiting for marriage from 6 years, marry Amma pls bless us for the marriage, pls bless ma, now we both r in helpless.... Amma pls bless us to start the new life,,,,waiting for Amma ur blessing,,,, pls bless us ma.... cbe 2015-05-22
2015-05-22
ak Dear mother today is my mumy birthday pls bless her give u r blessings,graces vit long life pray to Jesus devaam asking dis as u r son my father Jesus ...Amen y 2015-05-22
muthu rajendran nandri thaye enkkal sriram arokiyamaga vaalvangu vazha arup puriyum thaye. athe pol periyavanukkum kuzhanthai pirakka arul puriyum thaye shosthirem chennai 2015-05-22
ra Ponnamme...I am feeling guilty and sad.Am I behaving properly to all?If not please help me to behave nicely to all.Make me calm. Amme... nth ing is happening as I expected. I feel nobody understands me . ponnamme you know what is my problem.please give me peace of mind. Help me AMEN yr 2015-05-22
b Aennikariyilla mathavae aentha ee manushyar enjannae kkae njn ee bhoomiyil janichappol muthal oro snehikkinaallkarum aenniku nashtapaeduva oru thettum chaeyatha aennae aentjina enjanae parikshikkunath jivannu thullyam snehicha purushanaeyum nashtapaettu ....aenniku aellam naeridan sakthi tharannae oru nalla dctr avannam athae ulllu C 2015-05-22
Stephanie Please ask our lady to intercede for me to our Lord, that a relationship can finally be complete and two people can be at peace together in this world. Many thanks. UK 2015-05-22
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.please solve my problems amma.give me government job amma.thankyou amma. varahapatnam 2015-05-22
maniyan paramasivam amma. i am sorry for all my bad things i did so far amma.. i will stop doing all these bad things amma. i will not do these things .. i will stop it and i will do good things. i want all my requests to be good. it will help me to not to divert my mind amma. i am extremely sorry amma. i feel so so sad because of i could not able to be no.1 medical physicist in the world. amma. i love you amma. i need you always here amma. with your blessings maniyan paramasivam. i come to you and threw all my things away and asking my requests to you amma. as i said if i get all of my wants and requests it will helps me to be good. amma. give me a good mind amma. and happy life. i have not got my requests amma. i hope i will no.1 medical physicist in the world . getting good name from everyone amma. with your blessings maniyan paramasivam noida 2015-05-22
r Thank you so much for your love and kindness amma. Thank you so much for your grace. Please be with me through this hfouread process. Please help me get the card on time so that I can get the permit on time. Mathave, I pray that you be with me and help me with everything. I trust in you for all things all possible for those who trust in you. Kathu kollane amme. Koode undayirikkename amme. You are my strength and my refuge amma, i trust in you. Father Lord, Lord Jesus, holy spirit, appe, kaval malakhamare, kanyattunirappu muthappanmare, st antony appacha, st jude appacha please please please be with me and help me defeat my enemies who try to block my path to progress. Please be with me and help me amma. Kathu kollane amme. slo 2015-05-22
Roche Victor Maria Doss Nandri Mother Mary , Amen Chennai 2015-05-22
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house, good increment good promotion. Mother please bless us sort our family dispute. Mother please bless my family peace n happiness. Mother please bless my dad eternal peace. Mother please bless my mom eternal peace. mumbai 2015-05-22
stephen c Dear People Of God, I thank very much Jesus< Mother Mai and you people of God for all the petitions, grace and favors received this week. Thank you Jesus praise you Jesus Love you Jesus. Stephen a servant of Jesus. Mumbai 2015-05-22
JAYASHREE NAIR I pray to Vellankanni Matha to bless my husband, Murali with good health and free him from all illnesses.I bow to you with faith in my heart. Bokaro 2015-05-22
Swetha mary Mamma i don't which guy will get as my husband. please Amma i beg you to bless me with a good guy with a good background. I am scared amma about my life pleaseeeeeeeee amma help me and blessing me to get a good family...... Please amma i am helpless and i need your help amma ..... Amen..... Amen...... Amen...... Bangalore 2015-05-21
pramila mathew thank u mother for my successful operation and now I want success to be united with my family who stay away from me as I am working here. Pray for me so that I am transfered back to Mumbai and able to go back to my family Ahmedabad 2015-05-21
blanche stella miranda on 19th may my manager came to my table shouted at me before all colleagues. i could not complete the job given since it was anew job. he told me few years back that he does not like me and there are others who do not like me as well. this has upset i cannot sleep and am feeling depressed.this man is very lazy and only wants to take credit for everything. he gave me lowest raise in my salary this year. mother mary let me not feel depressed. my son SSC results are going declared within the next two weeks pray that he gets a good percentage mother mary watch over me and let him not insult me again like that day. malad 2015-05-21
blanche stella miranda on 19th may my manager came to my table shouted at me before all colleagues. i could not complete the job given since it was anew job. he told me few years back that he does not like me and there are others who do not like me as well. this has upset i cannot sleep and am feeling depressed.this man is very lazy and only wants to take credit for everything. he gave me lowest raise in my salary this year. mother mary let me not feel depressed. my son SSC results are going declared within the next two weeks pray that he gets a good percentage mother mary watch over me and let him not insult me again like that day. malad 2015-05-21
blanche stella miranda on 19th may my manager came to my table shouted at me before all colleagues. i could not complete the job given since it was anew job. he told me few years back that he does not like me and there are others who do not like me as well. this has upset i cannot sleep and am feeling depressed.this man is very lazy and only wants to take credit for everything. he gave me lowest raise in my salary this year. mother mary let me not feel depressed. my son SSC results are going declared within the next two weeks pray that he gets a good percentage mother mary watch over me and let him not insult me again like that day. malad 2015-05-21
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-21
Nancy Please pray that something good works for the project invested by me in HDIL at Palghar. Please pray urgently. Please also pray for my elder daughter and my sister and my niece to get good jobs. Please also pray for rain and good health and love and peace and happiness and our travelling everyday Mumbai 2015-05-21
Nancy Please pray for my younger daughter for a better career and gets a very good job. Mother Mary please hear my prayers. Please also pray for my elder daughter to get a good job. Please also pray for her urgently. Please also pray for my son-in-law for a better career. Mumbai 2015-05-21
ambily damodaran I am working in saudi.my vacation is on june 12th.i got my ticket also.but because of staff overlapping my vacation is hold.i want to go to see my 3 year old child.i alwayx telling toy child that i am coming on june wit toys.i want to see my husband and my child.pls pray for me to get my vacation on june 12 2015.mother mary knows my pain to see my child.pls pls pray for me saudi arabia 2015-05-21
ambily damodaran I am working in saudi.my vacation is on june 12th.i got my ticket also.but because of staff overlapping my vacation is hold.i want to go to see my 3 year old child.i alwayx telling toy child that i am coming on june wit toys.i want to see my husband and my child.pls pray for me to get my vacation on june 12 2015.mother mary knows my pain to see my child.pls pls pray for me saudi arabia 2015-05-21
Ajoy Dear Mother, Thank you mother very much for this day and for all the favors granted. Mother please bless us blissful happy healthy married life. mother please bless my sons good health, make them peaceful and normal child. mother please free us of all worries, free us of tension. Mother please bless us sort our family dispute. Mother please bless my parents of good health. Mother you know about our dreams..please be with us to fulfill our dreams. Mother take care of my babies. Mother show us the right path and lead us. Bangalore 2015-05-21
r Thank you so much amma for your love and kindness. Thank you so much for your love. Amma, I pray that the hearing against me be quashed. I pray that the people who are trying to destroy my fundamental right to work, self respect and dignity be silenced. Amma, I pray for my ear card amma and I pray that I get my job amma. Please please please be with me amma all the days of my life. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattunirappu muthappanmare, st antony appacha, st jude appacha please please please be with me and help me with everything. Kathu kollane amme.Apathonnum varuthathe nokkename amme. Amma, please do not let my enemy win against me today. Please make tanya quash their evil plans. Kathu kollane amme. slo 2015-05-21
r dear mother thank you for helping us get the payment long outstanding only by your grace it has happened, we beg you lord for your precious blood for the children change them help them to do work keep the house clean help me to loose weight help cl at his work place open some door mother for cl to change his tension job give him some peace of mind help clarance bless him wit a good job mother bless all jobless help mylain for her marriage help nikita to get a good boy help us in our financial issues help us to get a good increase and for our timings to change. m 2015-05-21
m Dear holy mother..my father has been suffering from witchcrafts since 9 months.a lambadi lady had done black magic to my father since he asked to pay her loan debt.she did for 3 times in a period of 9 months .firstly to become mad man,secondly to get heart attack,thirdly to kill him and see his death. She is doing along with group of members ,by any ways to kill my father. She is doing for every amavasya. He will do very severe vomitings at that time.his health was totally spoiled suffering from severe gastric trouble, gastric indigestion, gall stones,prostrate gland problem ,also aayasam,urine problem, knee pains,not sleeping and not eating properly, trembling during nights..amma pls heal my father and give him deliverance from all evil bondages.. Amma pls help my father to get relieve on Saturday.tomorrow he will talk with higher officials .pls allow the h.o to give or sanction the letter of relieve on Saturday for sure..thnq mahboobnagar 2015-05-21
muthu rajendran ellam un seyal thaye shosthirem chennai 2015-05-21
n please amma intercede for me unite me and shobu in marriage please amma and anusha mam mood becomes good please i clear dha/moh in my first attempt and get a good job there shobus parents agree for early marriage karntaka 2015-05-21
Reema For the court case against my Mother Thelma. So that the case may be on our side Mumbai 2015-05-21
pradeep raj No peaceful in my family, always problem in family I completed BE 3 years looking 4 job, still no Job ,misunderstanding between me n my loveable person now she going to leaving me, 6 years relationship...now she is not feeling good in health wise, Very painful for me, mother marry Amma pls hear my prayer... And solve my all problems amma. Marry Amma.... Post this prayer in verysad marry Amma, help me Amma coimbatore 2015-05-21
raja Amma last 6year's me and my lover waiting 4 marriage stil, her family members giving programs, not give permission 4 the marriage I'm like 2 do marriage with parents permission n in front of the all with Amma marry blessing n all of my parent's blessing... Amma pls help us n blessing ur child to live with loveable life and peaceful life... Now we bothin helpless Amma pls help and bless us ma. cbe 2015-05-21
B MALLIKARANI MOTHER MARY PLEASE AMMA GIVE A SATIFICATION IN MY ELDERSON S M BALAJI PARAMESH JOB AND PLEASE AS A MOTHERS REQUEST REMOVE ALL DEPRESSIONS OF MY SONS AND MAKE HAPPY OF FAMILIES CONNECTED IN MARRIAGE AND HIS BRIDES FAMILY ALSO BE JOY AND HAPPY IN THIS MARRIAGE AND LEAD US TO CONDUCT THE MARRIAGE HAPPILY AND MY HUSBAND AND MYSELF ALSO TO BE GOOD HEALTH PLEASE AMMA HEAR MY PRAYER REQUEST AND GIVE ME PEACE I AM NOT IN GOOD HEALTH AND I AM WORRYING ABOUT MY SONS DEPRESSION NAGERCOIL 2015-05-21
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless my village for the good development.specially for the cement roads.thankyou amma. varahapatnam 2015-05-21
bujji Dear mother pls pray for me to Jesus Deva naku ivala na dram lo vaka awesome one came I think he is my better half pls mother I want him as my love he is perfect to me and I saw his face but am not clear cut face after awoke sleep pls Jesus make him to meet I decided he is my life partner he wear blue stripes formal shirt I want him Jesus pls mother pls pray for me to Jesus avay prabuva am asking did in d name of u r son my father Jesus ....Amen g 2015-05-21
Rose Mary Amma my dad name is Anthony and he is very scared because of the Operation which he had underwent a surgery in 2013. Now he his facing seviour problems everyday .please amma pour him your spirit and help him to cure from all the problems and bless him with good health and also Help my mom in order to have a good health please help amma my dad in order slove all the problems based on his health . I hope from this minute he won't face any health problems ..... Amen ..... Bangalore 2015-05-21
JENNIFER Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion good full time maid sort family dispute dad eternal peace, avi n me free worries n free tension. Mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. Mother please bless my mom good health. mumbai 2015-05-21
shinu Mother Mary help us to get a good job for leeba. She is desperately looking for a job but her talents are not being able to use.She has become negative in herself.Pl help her & lead us in your way always.You always helps those in need as a mother.Amen Bhopal 2015-05-21
Roche Victor Maria Doss Nandri Mother MAry , Amen Chennai 2015-05-21
K. VIDYA SHOBANA VELANKANNI MADHAVUKKU STHOTHIRAM ENGA SARAVANAN SIRKU COIMBATORE C&S POST KIDAIKKA VENDUM. ADHARKU NEENGAL THAN THUNAI. COIMBATORE 2015-05-21
b Jesus I surrender my husband, his extramarital affair and the other woman at thy feet. My husband needs deliverance from this bondage as he repents for what he has done but is caught up in the trap as the other woman does not want to break up the relation and is desiring to continue and marry him inspite of being aware of the fact that he is married. She is willing to compromise at any extent but not wiling to give up. my husband too does not want to be harsh with her as he knows he has cheated on her. he loves me very much and does not want me to leave him but to be with him during this times of misery and anguish. He is in a very difficult position as he knows the other lady is too strong and will not give up easily though he tries to make her understand. my husband is not sure if he will be out of this bondage and if things will continue like this. He is helpless. Jesus I dont know what to pray, but I want you to rescue my husband, save our marriage and do something that will transform this lady and move her out of this relation safely, amicably and peacefully. Amen Amen Amen. Mumbai 2015-05-21
j I beg your powerful intercession to take a favorable decision for me. Please bless me to have favorable decision. d 2015-05-20
shierly Amma Madhavae,Thankyou for every good things for my family. My son is going to mumbai to join a new job and the place mumbai itself is new for him. Please be with bim always when he goes out and come and give him patience and humbleness when he moves to his superior, hotel collegues and the room mates because we don't whether they are good or bad.Please pray for my husband to show affection and love towards my son as he is going far away from us.My son should not indulge in unwanted activity.Please with him always.And pray for my daughter as she is going to attend a interview in a school by friday,please be with her always to do the activity well.AMEN west tambaram 2015-05-20
j.sasikala mary mother pls bless me and my friend salma to get a good job pls amma bless me to get a job quickly neyveli township 2015-05-20
Nilam Lakra Mother Mary, I need a baby,,, please help me give your blessing on this, Plsss maaa Your daughter, Nilam Ranchi 2015-05-20
mahesh Dear amma please bless all tenth class students.bless my school.today coming result amma bless amma.bless specially maths subject they have to score good marks amma.thankyou amma. varahapatnam 2015-05-20
daughter madha amma, manasu romba kashtama iruku ma...ellarum ena thapa pesranga.. kashtapaduthranga amma.. en familye romba kashtapaduthu amma.. seekrama en kuttan manasa mati enga veetla oru nalla vishayam nadaka vainga amma please.. en kanneerukum prayer kum balan thanga amma please... kanyakumari 2015-05-20
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-20
IRENE ALEX MY FATHER PASSED AWAY ON 09MAY2015 NOW THE ISUUES ARE IAM 46 UNMARRIED IAM WORKING WITH SALARY OF 18700 I HAVE LOAN AMOUNT OF 1LAKH TOTAL I HAVE 56000 IN HDFC BANK OUR OWN HOUSE IS PLEDGED IN BANK FOR TOTAL AMOUNT 10 LKHS NOW WE GET INTEREST 6500 PENSION IS 5250 TOTAL OH MOTHER NOW DEATH CERTIFICATE IS REQUIRED AFTER THAT WE NEED TO GIVE IT TO SO MANY OFFICES EVERY THING WAS IN MY FATHERS NAME OH MOTHER NOW I HAVE ONLY MY MOTHER SHE SI 71 AND I LOVE HER A LOT PLEASE PRAY FOR ALL OUR PROBLEMS THAT WE FACE IN LIFE ALONE ME AND MY MOTHER I DO NOT WANT HERTO SEE HER WORRIED PLEASE PRAY FOR ME HAD NO MONEY TO CURE MY PAPPA HE WAS 77+ ernakulam 2015-05-20
Jaya balihar Please pray for my brother in law satyajit john balihar.he will have his 4th chemotherapy on 22.please pray all his report s are normal.please pray for my friend mini s husband Rajiv verma to get a good job soon. They are facing many problems please pray for the entire family give them strength.Show ur mercy and blessings upon them. Jamshedpur Jharkhand 2015-05-20
ra My dear loving velankkanni mathave. .. kaathu Rakshikkane. Ellavarkkum nallathu varuthane. Amme.. please clear my mind.I need sketch peace and silence at home. Now I don't have any privacy at home . Nobody understands what I want. Every body thinks that if I appoint a servant all my problems will be solved.No amma. .It is not like that . I need my personal time without any disturbance. If I tell any body that I want to sit alone they will feel bad.So I am controlling my emotions maximum. I am really frustrated. Sometimes I am loosing my temper . Amma...Please help me Amma. Thank you for all your help.AMEN yr 2015-05-20
m Dear holy mother.. My father has been suffering from witchcrafts since 9 months.a lambadi widow lady had done black magic to my father for 3 times,firstly to become a mad man,secondly to get heart attack, thirdly to kill him at any caust and by any means joined with a group of occlustic workers trail by trail attempting to kill my father. For every amavasya she is doing black magic and one of my father assistant is helping her joined hands with her to kill my father.. Amma my father health was totally spoiled suffering from severe gastric indigestion, gastric problem, gall stones,prostrate gland problem,uination problem, not eating and not sleeping properly, trembling, fearfulness.. Amma your lady of good health so pls touch my father and heal him.give him deliverence from all evil bondages, witchcrafts power.thnq mahboobnagar 2015-05-20
muthu rajendran amma nee enakku vazhi kattu thaye shosthirem chennai 2015-05-20
BINJO PHILIP dear amma, i am now working in abudhabi, now they relocated me new office, that office i want work good and my job also getting permanent job ABUDHABI 2015-05-20
2015-05-20
RAMYA GANESAN matha i failed in many attempts in jaiib exam...... pls brig a victory ... i got 60 mark to clear the exam..pray for me mth pls............ NAGERCOIL 2015-05-20
Niya Mother mary thnk u so mch fr ur kindly blessing fr ma sister u gt a wonderful mrk in entrance ....mother mary pls let my sister to study in achchen cllge so tht i cn and go and appologise ma mistake and all our misunderstndings plsss mother mary ths only throufh a way i cn meet him u kne tht he s vry away frm me plsd amna u r only there fr me plss dnt leave me.. ker 2015-05-20
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-20
carol noronha Dear mother,Thank you for helping my son to pass thank you for giving us an opportunity to go to see my son by the end of this month.thank you for every thin gin our life. please bless my son and help him to do well in his Iets exam which is in the next few days please help us to have a good and safe trip help him with the best job which is going to pay him the best as a bakery chef manager.Help him to get his work permit and his citizenship. mumbai 2015-05-20
Roche Victor Maria Doss Nandri Madhavee... Amen Chennai 2015-05-20
mahesh dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma for the good result.thankyou amma. varahapatnam 2015-05-20
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion good full time maid. mother please bless my mom good health, mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. mother please free avi n me of all worries n free tension. Mother please bless us get a good full time healthy maid mumbai 2015-05-20
JOHN MOTHER PLEASE BLESS ME TO OVERCOME ALL OBSTACLES I AM FACING RIGHT NOW IN MY PRESENT WORK, EVEN AT HOME OR OFFICE I AM CORNERED AS SINGLE, I COMMIT MYSELF INTO YOU MIGHTY HANDS. I AM CONFUSED WHAT TO DO WHERE TO START, GUIDE & GUARD ME. mt 2015-05-20
Gillian Father I ask you to pray for my parents to unite with me and Remo (my husband). I beg and plead with you oh Most Heavenly Mother of God to bring back our families together and reunite as one. Please forgive remo and my sins for all that we did wrong towards my parents. Please bring my parents back to me. Please draw both Remo and myself together towards you and your son Jesus Christ. Help us to grow in love not just now but always. I ask this in Jesus name. Amen melbourne 2015-05-19
ps Please pray for Dushi. His immigration interview is today and please be with him through out the interview and bring him a good result. Please forgive all the mistakes he did and help him to be a good man. Please be with him always amma. canada 2015-05-19
m Dear holy mother..my father has been suffering from witchcrafts power and evil bondages since 8 months. A lambadi lady has done black magic to my father she wants to kill my father by any means. First she did black magic to become a mad man and roam on road side secondly she did fe his heart to get heart attack thirdly she did to kill him with a group of members.amma pls save my father protect him from demonic possession.she will do for every amavasya.amma by any means,at any caust she want to kill my father. His health is totally disturbed suffering from gall stones,prostrate gland problem, urine problem, gastric indigestion, gastric trouble not eating properly, sleeplessness ,trembling during nights.amma pls touch him and heal him.give deliverance to my father.. Give him mental Peace...keep away all tensions to my dad.thnq mahboobnagar 2015-05-19
mr Dear amma...pls change my mother..her behaviour is so arrogant at my father.. Pls teach her how to talk and how to love her husband.. Always she talks in different manner,her words will b painful to hear..and also change my father his behavior. hyd 2015-05-19
shaji Ammey mathavey thanks.Ella nanmakalkum ammey anugrhikaney.kunjunyum.molyum anugrhikaney.chettathey ammey anugryikaney .duty il Kathy kollaney.ellam ammyudey munpil arpikunu.amen. UAE 2015-05-19
Muthu Rajendran amma ennai vazhi nadathum thaye shosthirem chennai 2015-05-19
SM Please pray that RephSa,SS and SMV get success, victory and peace at work, that all three sales happen smoothly for SMV that Crm co-operates fully and I have victory and that Rephsa has peace and does well in school and we have a safe and happy journey and a very good year ahead for me and Ramm has victory at work. AM 2015-05-19
ra Velankkanni mathave. .Thank you for helping my youngest daughter. Please continue your support and help amme.AMEN yr 2015-05-19
maniyan paramasivam amma. i am sorry for all my bad behaviors i did so far amma. if i get all of my requests it will help me to be good and do good things amam. be with me and bless me amma. i come to you and asking you amma. i hope i got all of them. i need you amma. make me so so perfect and very very confident amma. i should be no.1 medical physicist in the world amma. give me all your blessings to me amma. i need you amma. i need you amma. and give me the requests of being so so fast in working, very accurate, very smart and very sharp, very very fast learning ability, everyone respect me, very intelligent, brilliant, everyone likes me, getting good name from everyone, being so so active, good memory power, very fast skills acquiring ability, very fast thinking mind, very fast problem solving ability, very good confidence and concentration, patience, very superb mind, very clever, wise mind, goal reaching skills, amma. i need you amma. being so happy always , very very clear understanding ability in fast mode, and very good planning and plan executing skills, very good communication skills, very healthy, successive person amma. with your blessings maniyan paramasivam noida 2015-05-19
maniyan paramasivam amma. i come to you and i submitted my wants. amma. you want me to be good throwing all my bad things, i am ready to throw it amma. and i need all requests that i asked so far. it will really help me to be good and getting very very high salary, being so so active, and happy person amma. with your blessings maniyan paramasivam noida 2015-05-19
Mary Ammae hpe ma suster wll gt gud rankings in hr exms ....and i hpe tht i wlll also pass ...pls pray fr me mother mary as i m in trouble ...ma guy who i m lving s nt understndung me since 1yr plss amma pls let hm to cme to ma lfe plss let ma sissy also wll gt adm in hs cllge....pls mother mary i m begging u i m really sad thnking abt ths plss let hm to understnd me k 2015-05-19
A Ammae plsds ethil kuduthal aenniku padikkan vayys athramathram njn kashyapaettu padichu ammae ee pravashyamaenkilum njn pass avannae aennae kaividallae enni ammayum pithavumanu aennikullath ammae aenae kaividalllae aentae vishamanjal manasullakki aennae pass akkanae parentsintaeyum mathvae.... nee aennnae kaividullla aennnu aennikariyam mathavae aennnikh vaendi karhavinnodu apakaeshikkkanae ....ammae D 2015-05-19
mahesh Der amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless alla tenth class students tody coming results bless them and bless school also.thankyou amma.bless specially maths subject they have to get good marks amma. varahapatnam 2015-05-19
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-19
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-19
JENNIFER Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of tension, good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please bless us free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my mom of good health. Mother please bless my family peace n happiness. Mother please bless avi n me good blissful married life. mumbai 2015-05-19
Sheeba Amma,Now the president gave the complaint to messsuare the plot again.we don't know what will happened.we didn't get the approval to build the compound wall and we didn't take the big tree.Please Amma help my parents and my sister. please Amma.......We all are very sad. Amma please tell to the opposite parties and the panchayat president to leave this and go back.please Amma......... Amma, tomorrow 10th result.Please help my sister to get 100% result and her more students get 100 marks in maths subject.Please Amma...... Kuwait 2015-05-19
A Fernandes dear mother, Please bless my daughter with good health and to get a positive response. Mother take away all the depression from her and let her be blessed. Keep her continuously mother under your care..thank you mother a million times mumbai 2015-05-19
2015-05-19
2015-05-19
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-19
C R Babu Amma Velankkani Mada I beg plead and pray to almighty God to bless and guide my daughter in her trip to France and she safety returns back without any problems. Kochi 2015-05-19
menaka my dear mothermary.I thank you for gift of job. now I apply for house lottery. I request you to pray for me to get house and peace in family .pray for baby girl. . mother mary pray for my brother family there living separate please help them to join ... mumbai 2015-05-18
Remya Dear mother mary, Mother Mary I am searching for a job in Australia for past 3 months .Pray to your beloved son Jesus Christ to help me get a job at the earliest. thank you Lord for all the blessings you have given me through mother Mary. Australia 2015-05-18
JJ Dear Mother, Please help me and especilly my family member to overcome the problem which we are facing with regards to our property.Please work everything for our favour and for our good. India 2015-05-18
manaswini Mother, today is my birthday and I pray to you to send me my love. Let him come to me and be with me for some time.Thank you holy mother. Hyderabad 2015-05-18
suchitra vijay Dear Amma,First i would like to thank you that i got job.Please help me to perform in this job. Still my husband yet to to find a good job. Kindly help him to find a job as soon as possible amma. in the meanwhile we are facing lot of prblm in our house. All these issue shld. come to end. kindly give me the strength and courage to manage all these things. give me wisdom while speaking to them. New Delhi 2015-05-18
A Plss mother msry achachrn s nt gving any replies plss let hm to reply me ...and i hve exms tommorow plss gve me all the strength and plsd mke me pass plsss ammma... C 2015-05-18
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-05-18
Amolorpavamary Mdm.Amolorpavamary is suffering from gall bladder stones and mild heart block.She is eighty years old Lord Pls heal her .Work miracle in her life dissolve her stone.70 Ipoh 2015-05-18
n amma intercede for me unite me and shobu in marriage please his parents agree and my parents agree for early marriage please amma and apollo posting goes calmly and cooly and please moh/dha i clear in my first attempt securea good job and please give my father peace of mind nad more patience karntaka 2015-05-18
Anusha kanna Dear mother tomorrow is my parents wedding anniversary pls pray for them they should be happy and healthy for ever pls gve u r graces ,blessings on them pls mother pray to Jesus Deva am asking dis as u r son my father in name of Jesus ...Amen g 2015-05-18
m Dear holy mother ..my father has been suffering from witchcrafts since 8 months done by a lambadi widow lady as my dad asked her to pay her loan debt.she did for 3 times first to become mad man secondly to get heart attack third to kill him at any caust.she is doing black magic to my dad with group of members. She is doing for every amavasya amma today is amavasya we are so scared and been tensed what might she did today to my father. For every amavasya he will get vomitings and been fallen sick.he is suffering from severe gastric trouble, gastric indigestion,gall stones,prostrate problem, urine problem, knee pains,not sleeping properly during nights,trembling in nights,not eating properly. Amma pls save my father and protect my father. We can't live without my father. Amma give deliverence to my father from witchcrafts and evil bondages and evil spirits.. Pls save my father's life from that lambadi Lady's hand.thanq mahboobnagar 2015-05-18
maniyan paramasivam amma. i love you .. i want you to be with me and bless me forever amma. i am sorry for all my bad things i did so far amma. i just believe in you amma. i hope you will be with me always and make me so wise and intelligent and brilliant amma. i love you amma.. make me so so bright and very sharp and very smart amma. i should be no.1 medical physicist in the world amma. be with me and bless me amma. with your blessings amma. maniyan paramasivam noida 2015-05-18
Rohan Daniel Nair Dear Please help me divorce to end smoothly without any complication and avoid more issues with the court and police. Protect me from any people who are planning to attack me in near future and help me defeat them in their plans, Bless me with the knowledge, wisdom insight and connections to help get out of all evil plans of evil men and their evil ways. Connect me with the people of GOD. Lord be with me as I don’t have anyone beside him to fight on my behalf. Nothing is impossible with you my Lord and I love and praise you!! Regards, Rohan Daniel Nair Vasai 2015-05-18
Muthu Rajendran amma ennai vazhi nadathum shosthirem chennai 2015-05-18
C R Babu Amma Velankkani Mada I humbly beg and pray to God for victory of CSK in tomorrow's maktch Kochi 2015-05-18
sundara reddy mother mary bless me and my hospital. one patient got bladder complication during surgery.please touch her with your healing hand and recover her health to normal.save her . you only can save her.mother of health accept my request and heal her. chilakaluripeta 2015-05-18
serin PRAYER REQUEST Dear Priest Iam Serin . Njan UAE il ANnu Work Cheyyunnatu. Kazinja 4 years yi NJanum Divya ennu Parayunna Penkuttiyumayi Pranayattil ayirunnu. Eppol atinte avasan khaddattil ettichernnirikkuvanu Njangal. Adyamokkeaa avarudeaa Veetukarkku NAlla Etirppu Ayirunnu. Eppo Daivam TAmpurante Anugrahattal Avarude Veetukarum Etttandu Oru Sammatam Mooliyittundu. But Ennalum ENte MAnassil Tension Annu. Because Financially Avaru Nalla High Annu. NJangal Pattaniyum Daridravum Ellam Arinju VAlarnnu VAnna oru Family Annnu. Avalea Enikku Ottiri Iztamanuuu, Atukondu Tanneaa aval illatta oru Life enikku Alochikkaneaa Vayya . Eppol ENte daivattinte Anugraham kondu Avarkku Enneaa Accept Cheyyann Kuzappam illa enna paranjeaaa. Because Ennalum NJangal Pavapettavaru Ayakondu Enikku NAlla tension Annu. Nalea Avalea Pennu KAnaaan Ente Veetukaru Avaludeaa Veetilekku POvaaanu. Avarkku Ente VEetukareaa IZtapedanum. Ente Veetukarkku Avalude Veetukarea Iztapedanum . TAmpurante Anugrahattal Ellam BAngiyayi Nadakkanum Njangalkku Vendi Onnu Prayer Cheeyumooo Plzzzzz…….( Ente Divya Moh Selection Kitty NIlkkuvanuuu Medical , Interview ellam Kazinju Visa Yum vannu But etu vareaa ticket Vannilla . Avaludeaa koodeaa tanneaaa ellam kazinja avaludeaa kootukari chinnuvinu ellam kitty aval 20th nu pokuvaaa. Eppozum ente divyakku ellattilum Tadassangal annu Atu koodeaaa onnu maraaaan Daivayi Prayer cheyyumoooo Enteeee eeee prayer Request Nokkateaa pokallleaaa plzzzzzzz….) UAE 2015-05-18
Deepa & Gerard Dear beloved Mother, we are requestions for good health for the twins which you have blessed in my womb. Now in my 8 month of pregnancy, I am getting very scared of the scan reports where there could be a possibility that their could be genetic disorders among one child. O Miraculous Mother just as how u are carrying baby Jesus in your arms, give us an opportunity to carry 2 completely healthy and normal babies. We place my womb at your feet plz bless it wit 2 healthy babies. Bangalore 2015-05-18
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.bless alla tenth class students result should come well amma.bless them amma.give me governmnt job amma.thankyou amma. varahapatnam 2015-05-18
B MALLIKARANI AMMA PLEASE BLESS TOMORROW FUNCTION RELATED TO MY SON S M BALAJI PARAMESH MARRIAGE AND HE HAS TO CATCH THE TRAIN IN RIGHT TIME AND TO ATTEND THE FUNCTION WITHOUT DELAY AND PLEASE AMMA BLESS ALL AND YOUNGESTERS AND MY SONS NOT MEET ANY ACCIDENT DURING THEIR JOURNEYS AND BLESS THEIR JOURNEYS AND AMMA SHOW MY SECOND SON WHICH PATH TO LEAD HIS CARRIER WHICH IS RIGHTWAY TO HIS FUTURE LEAD HIM ALSO IN A RIGHT MANNER AMMA AND BLESS ME TO DO ALL THE WORKS IN GRAND MANNER AND WITH MY DAUGHTER IN LAW LOVELY AND IN AGOOD MANNER AMMA AND GIVE ALL THE FINANCIAL NEEDS LEAD ALL IN A GREAT MANNER WITHOUT ANY PROBLEMS BLESS OUR JOURNEY TO MADRAS AND LEAD US IN AHAPPY AND RIGHT MANNER NAGERCOIL 2015-05-18
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-18
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-18
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-18
vinu thomas amme mathave njangalku nee dinamprethi tharunna anugrahangalkai njangal ninne sththikkunnu. amme njangal anubhavikkunnu kashtapadukalil ninnum sambathika njerukkangalil ninnum veedum joliyilatta avasthakalil ninnum njangale karetti tharane ennu njangal ninnodu kenapekshikkunnu. njangalku vendi angayude puthren thamburanodu mathyastham vahikkaname ennu njangal ninnodu apekshikkunnu. KOCHI 2015-05-18
john fernandes Pray for good health and thanks for a safe trip. thanks for all the favours granted and also pray that we receive blessing from Mother Mary in our future needs. santa cruz 2015-05-18
jennifer Dear Mother, Thank you mother very much for this dad and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful free us of all worries, free us of all tension, good full time maid, sort family dispute, dad eternal peace. Mother please free avi n me of all worries n free us of all tension. Mother please bless avi n me of good health n job satisfaction. Mother please bless my family peace n happiness. Mother please bless my mom of good health. mumbai 2015-05-18
thavrin pillay pray i thavrin pillay pass my third year of dentistry.pray i study well.pray i write all my dentistry papers to the best of my ability.pray for my protection and divine guidance.pray for my wife shamantha reddy that is pregnant.also pray for my mum who has breast cancer.pray for our good health,wealth and happiness.pray for our success and prosperity.pray i get a seat to study orthodontics Johannesburg 2015-05-18
Anusha kanna Dear mother tomorrow is my parents wedding anniversary pls pray for them they should be happy and healthy for ever pls gve u r graces ,blessings on them pls mother pray to Jesus Deva am asking dis as u r son my father in name of Jesus ...Amen g 2015-05-18
ak Dear mother today is my parents wedding anniversary pls pray for them they should be happy and healthy for ever pls gve u r graces ,blessings on them pls mother pray to Jesus Deva am asking dis as u r son my father in name of Jesus ...Amen g 2015-05-18
Sweebert Dear Mother Mary, Thank you for all the favours received especuially got a good bonus from the company. Mother Mary , please pray for me to have a peace of mind, peace in the family and also to have control on my angerness and to have patience in dealing things. Bahrain 2015-05-18
Philomena Rodrigues Dear Mamma Mary, please grant my wish of gifting a good house to my Mom & Dad. Please be with me in every converstation that i ll have with the Builder in this week for granting my Mom& Dad a house in good locality. Please change their minds and let the decision be in our favour. Maama Mary , please intercede for me. Mira Road 2015-05-18
j Amma, Please save me from the situation which i am facing in the office. Please provide a decision from my boss which is favorable for me.Please shatter the arrogant behavior of my colleagues.Please bless me with favourable decision. I beg your powerful intercession solve this issue by terminating that giril. d 2015-05-17
MANIYAN PARAMASIVAM amma. i love you amma. i am sorry for all my bad behaviors i did so far amma . i submitted my wants to you and asked you my needs amma. if i get all my wants and requests it will help me to be good amma. i come to you and asked you my wants amma. i hope i got all of them amma. i love you. be with me and bless me amma. with your blessings. maniyan paramasivam noida 2015-05-17
2015-05-17
sojin Amme velankanni mathave.palarum palareyum snehikkunnu.avarude ulli angottum ingottum ulla ishttam thudikkunnu.avar aa ishttathe kanunilla may have.njan otthiri as graphic hit funds aaarelum enne onnu ishttapettirunnu enkil.amme snehikkunnavare pirikkalle.avar daivathinte makkalnu.enne pole nalla veedum nalla joliyum illathavare kaivediyalle amme njan kaalupidikkam.enikke oru veedu tharaname nallaro joli.sneham otthiri aagrahichu.ennepole ullavane athinte yogyatha undo enariyilla.oralpam sneham enikke tharanema.kaivediyalle amme kerala 2015-05-17
2015-05-17
bujji Dear mother thanks for all Jesus thanku for things mother u know my situation pls teach them lession mother pls they should know d pain of my problem pls pray to Jesus pls I want a job pls pray for me ......Amen g 2015-05-17
Jacob Akhil Francis annai velankanni amma I attend the 10th cbse board exam I need 98% for all subjects and I need a better IIT coaching also pls amma pray for me alappuzha 2015-05-17
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.today catching amma bless amma.give me government job amma.thankyou amma. varahapatnam 2015-05-17
Leo John Bethel Dear mother, I got a new job in Kuwait. Mother I have to stay there for two years alone. Now I'm alone, on 19th May I have to go to Kuwait alone. The last time I saw my mother, now I feel like seeing her and also my family once again.Please take care of my family. Please take care of me while I am flying to Kuwait. Help me to work in company with my whole heart. Help me get good impression about me from my seniors and superiors. Give me good health. Mother I want to be a good and hard working guy. Because for six months it's my probationary period and so they can terminate me whenever they want. And this job is my life. Kerala 2015-05-17
r dear mother I beg you for don bosco school Kuwait is having a very difficult time rent for the school is increased very high so have teachers salary but the funds are less so the school will close mother pls help us let the ministry intervene for this to solve this help them have good teachers where will our children go without the school open some door mother help this problem to be solved and everything to go well reduce the rent of the school let this come as a fund from the govt I beg you for a miracle. help cl bp problem to be solved also for stella reduce their blood pressure grant them good health. mother I beg you for kids touch them spl my csy touch her let her not back answer but be kind loving to the parents and her brother too. help me to loose weight as I am trying but cannot do anything on this, I beg you for a miracle all are teasing me I am become a laughing stock help me for fasting give me the grace mother for 1 week / month also mother I beg for my mother in law her good health and for my parents too. help cl at his work place he is facing too much difficult for his cash counter not having proper brake timings help him for his reports of cash to tally. mother I beg you help open some door for him for a new job as here salary is very low, only you can help us mother. pls grant peace in the world touch the youth lord I soak this request of mine with your precious blood help us in our finances help us to get some draws of finances thru bank or a loan for us to get a house mother . thank you for countless blessings showered on us thank you for your grace mercy and your healing touch thank you for good health and for taking care of us. help cl for his reports to tally help him to get a new job too m 2015-05-17
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-17
Jaya balihar Please pray for my brother in law's good health. Also pray for my mother who has a ligament tear.pray for my entire family. Please pray that my friends husband gets a good job soon. Jamshedpur Jharkhand 2015-05-17
ra My dear Amma. ...Thank you for helping my daughter. She got good marks today.Please help and support her in the future exams also.AMEN. yr 2015-05-17
n please amma intercede for me unite shobu and me in marriage please his parents and my parents agree for early marriage moh/dha i clear in my first attempt and secure a good job in dubai or abu dhabi and tomorrow joining apollo all goes well and all be friendly towards me and please give my father aptience and peace of mind karntaka 2015-05-17
ra My dear velankkanni mathave. .. Why I am like this? I feel sad when I speak to others. Please make me to speak properly. Please please make others understand my feelings. I fed up with talking and making them understand what I want. Whenever I tries to open my feeling always it will become a big issue. I am fed up Amma... Please make them understand me . Amme. .. I need some personal time.I am really frustrated. I don't want to create enemies . Amma..earlier I was enjoying my house work and peace in the house.Now I feel frustrated and my responsibilities are increased. Please help me to solve the problems. AMEN yr 2015-05-17
m Dear holy mother. Save and protect my father from witce power evil spirits power.a lady had done black magic to my father as my dad asked her to pay her loan debt for 3 times in a period of 8 months.she want to kill my father and take his life.she is full of anger at my dad.his health was totally disturbed .suffering from gastric indigestion ,severe gas problem,gall stones and prostrate gland problem,urine problem. Not eating properly at all not sleeping at all.suffering from severe knee pains,joint pains.she is doing for every amavasya tomorrow is amavasya amma we are so scared what might happens to my dad..for every amavasya he is suffering from vomitings and been fallen sick in every month.amma pls save my father and protect him amma. mahboobnagar 2015-05-17
ak Dear mother thank u for all and pls give peace,graces, blessings to my family and pray to Jesus abt my job pls Deva u only d way for me and pls make to meet my soulmate as soon as possible ... Am asking dis in name of our father Jesus to yavy Deva...Amen g 2015-05-17
Muthu Rajendran AMMA NEEYEE THUNAI THAYE SHOSTHIREM chennai 2015-05-17
SM Please pray that SMV's three deals have full victory this week and are smooth and easy, also that SS is happy and victorious at work and that the interview is easy and victorious for SS and that all goes on well and that RSV and baby are fine and healthy that we find good wfor mulu. kk 2015-05-17
meetinder pardesi Dear mother Mary ...I believe in you a lot ..you r miracle in my life ....I strongly believe in you whatever you decided for my llife is going to be good..mother Mary I love one boy he wants to marry me .he love me a lot..my parents are not agreeing for this marriage as it is intercaste and he s not so financial secure..but mother Mary I Dont want to leave my parents and go with him...I want my patents also accept this proposal make some miracle that my parents accept this proposal once more..and rest I leave in you..whatever u decide will decide for my goodwill..I will accept it..love u mother Mary ..I m very tensed and frustated..thinking abt it...I m doctor..and he is also doctor ..plzzz mother marry help me ...take out of it problem ...mercy...have mercy on me delhi india 2015-05-17
ARLENE D' MARIESSA Praise The Lord!! I am Arlene from Malaysia. My prayer request is for my husband, Mr Karthik Thiruvalar who is waiting for the job application in Canada. We are planning to settle down in Canada. It has been 2 months, until now we have never receive anything on the application yet. I hope you will answer my prayer. Blessed the name of God. Alleluia!! Amen. Kuala Lumpur, Malaysia. 2015-05-17
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-17
jennifer dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension, good house, good increment, good promotion. Mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. mother please free avi n me of all worries n tension, MOther please bless avi n me good health n job satisfaction. Mother please bless us sort our family dispute. Mother please bless my mom good health. mumbai 2015-05-17
Sheeba Amma,My parents we are very sad because of the land problem.we got report from thasildhar. But the opposite parties are not allowed to take the wood.And we didn't get the approvel to build the compound wall around the plot.We applied the approvel but we didn't get the approvel.we want approvel from panchayat officer ie excecutive officer.But the panchayat president is there.so we are afraiding about him. He is always helping the opposite parties.Please help my parents and my sister to build the compound wall.Please Ammm...............But we don't want fighting case court etc. Amma,The opposite parties are decided to built the Hindu temple on my father's plot.Amma You must not allow to built any building or any thing.because you know this is my father's property.My father is feeling very sad.Amma help my father...................to win this problem. Kuwait 2015-05-17
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.thankyou amma for catching prawns.give me government job amma.thankyou amma. varahapatnam 2015-05-17
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-17
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-17
vinu thomas amme mathave nee njangalku dinamprethi tharunna anugrahangalku njangal nanni parayunnu. njangalude kashtthakalum vyakulathakalum durithangalum matti tharaname ennu njangal ninnodu apekshikkunnu .njangalku vendi angayude puthren thampuranodu mathyastham vahikkaname ennu apekshikkunnu. KOCHI 2015-05-17
Uday Shankar Dear Mother, My son is not taking eating the food properly, Mother please tell him to take the food properly. bangalore 2015-05-17
stephen c Dear People Of God, Please pray to Jesus to bless all my work for this week to go smoothly and grant all my petitions and prayers which i place before you. Thank you Jesus Praise you Jesus Love you Jesus. Stephen a servant of Jesus.. Mumbai 2015-05-17
stephen c Dear People Of God, Please pray to Jesus to bless all my work for this week to go smoothly and grant all my petitions and prayers which i place before you. Thank you Jesus Praise you Jesus Love you Jesus. Stephen a servant of Jesus.. Mumbai 2015-05-17
kavitha Henry Mother mary amma pls have mercy on me amma I got one good shop in the basement floor amma yesterday I went and saw and came its every thing in your hand your decision amma how ever you tell will do like that amma already i had first and 2nd shop loss amma for the third shop i should not be loss amma pls bless me and help me amma again i should not go under loss amma pls bless me and pls help me amma this time nothing loss should happen amma always be with me and help me this time amma pls don't leave my hand always hold my hand and be with me amma nothing wrong should happen to me amma always your blessing should be with me amma pls pls pray to specially this time any cost i should not fall down and i should clear all my debits amma all the amount should be credit amma no any debit amma always be with me amma know iam going to new shop no that should be lucky shop to me amma it should not be any problem i believing and iam stepping to that shop amma pls don't lend my head down amma always love my business and special pray to ur son jesus Christ that my daughter is steeping into a new shop so it should be success and she have to come in her life very big and very big business man amma nothing problem should be there always be with me and help me amma ,,,my husband should not do any thing wrong with any girls amma pls guide him and help my life amma always be with us amma nothing problem should be there amma don't leave my hand amma always for me that your with me iam thinking always me my husband and my daughter and son should be together amma love bless me amma Amen. Bangalore 2015-05-17
Anish Thomas Lord Jesus, thank you for the blessing you have showered on to us, been with us in all our good and bad timing. I Pray for the welfare of my family friend and co-workers. Praying the task I have taken up in profession need your guidance and support. Be with me and give courage Praying that the project we are taking shows sucess Mumbau 2015-05-16
Biju Most blessed, the studies of my son is not proper, bless him CG 2015-05-16
cecilysangita amma mary pray for my marriage , my marriage getting delayed pray for my mothers health and brothers job , sister priyas marriage. pray for our family joy and health happines.. i should get married soon with god fearign and correct and good life partner.. tamilnadu 2015-05-16
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-16
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-16
S F Dear Mother, With great faith & trust I am confiding in you to grant me my heart desire,Mother Dear u know all within me, people cannot understand me as to why I am opting/desiring this person, Mother sorry for my earlier fault when I had rejected this same very person & when things have become difficult I want him, Mother everything is in your hands to intercede to our Father & our Lord Jesus Christ.I promise to visit your shrine soon after marriage, pls grant this heart desire. Thank you Devotee Mumbai 2015-05-16
Renita Mama, please intercede for my request. Please help my friend to become a good human being Dubai 2015-05-16
n amma please intercede for me please unite me and shobu in marriage please amma and his parents and my parents agree for early marriage and i clear dha/moh in my first attempt and please secure a good job there and i am joining apollo on monday please everything goes smoothly and there people talk to me and friendly towards me karntaka 2015-05-16
m Dear holy mother..firstly I thanq and I praise u for giving us transfer to vij zone..my father has been suffering from witchcrafts since 8 months.a lady want to kill him and see my father dead body she is full anger at my dad As he asked to pay her loan debt.she did black magic for 3 times firstly to become mad man secondly to get heart attack thirdly to kill him at any caust.she is doing black magic with group of team members repeatedly and increasing the dose.my father healw was disturbed totally suffering from gastric trouble,gastric indigestion,gall stones,prostrate gland problem ,urine problem..night time will pass urine for 2-3 times not sleeping properly during nights..knee pains..amma pls save myfather's life ,protect him from that lady's witchcrafts power and give him deliverence from all evil bondages strengthen him heal him amma..she is diing black magic on every amavasya ama coming monday is amavasya,we r scared what happens to my dd what she will do?pls save my fathers life..thnq mahboobnagar 2015-05-16
Muthu Rajendran amma ennai nalvazhi paduthum shothirem chennai 2015-05-16
maniyan paramasivam amma. i love you amma. i submitted my requests to you so far in this site. if i get all of them it will help me to be good amma. i come to you and asked my requests amma. with your blessings maniyan paramasivam. i love you amma. i need you amma. be with me and bless me amma. i really believe in you that you will take care of me amma. noida 2015-05-16
B MALLIKARANI my son s m balaji paramesh marriage is on may 29 2015 please amma i am not well to do the marriage works please amma please lead all functions related to the marriage to be perform well and give strength to receive guests to the marriage in a better manner and the feast also to be tasty and to all guests get satisfaction to all the guests allare happy and all the functions to be conducted in a right manner with your grace amma you come for my son marriage amma and bless the couple and lead us without any problems NAGERCOIL 2015-05-16
B MALLIKARANI my son s m balaji paramesh marriage is on may 29 2015 please amma i am not well to do the marriage works please amma please lead all functions related to the marriage to be perform well and give strength to receive guests to the marriage in a better manner and the feast also to be tasty and to all guests get satisfaction to all the guests allare happy and all the functions to be conducted in a right manner with your grace amma you come for my son marriage amma and bless the couple and lead us without any problems NAGERCOIL 2015-05-16
lavi1 Mother Mary Bless me and my family.Please pray for me. uae 2015-05-16
Jessy I pray for good sleep in the night and peace of mind and good health Mumbai 2015-05-16
Deepik singh Llliver problem&fluid in stomach.prayer that report's come positive meerut 2015-05-15
ak Mother thank u Jesus thank bcoz I came to home vit out anyproblm thank u Jesus pls save me Deva. .. Amen g 2015-05-15
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake me and my loved ones and all people that pray zealously to seek Your Divine Intercession. Amen. --- 2015-05-15
Netty Mama marry plz let me get pregnant tru this ivf plz j beg u I want twins n if given a chance I will soon go for second child tru ivf I want lots of childrens Goa 2015-05-15
n please amma intercede for me unite me and shobu in marriage please our parents agree for early marriage and please amma pray for peace to chandu prem and mallappa sir please they dont torcher us mentally and everything becomes calm please give peace of mind to all my lecturers. karntaka 2015-05-15
Baalachandiran Kunaratnam,Canada Amma Please Solve our financial Hardship and Amma help through your divine son's blood to heal my shoulder pain. Canada 2015-05-15
Kavitha Henry Mother mary pls have mercy on me amma pls give peace of life to my grandmother she is no more in this world amma she is past away on 13.05.2015 at7.40AM amma pls bless her and let her leave peace of mind in this world amma without any tension she should not worry for any thing ,,,so many days she is worried for lot of thing amma know she should not worry for any thing amma let her leave peace of life in this world amma she should not worry for any thing amma pls bless her and give happy life to her amma after coming with you also she should not worry for any thing amma bless her amma saras amma always we are with you only amma love you so much and like you so much amma Amen. Bangalore 2015-05-15
HELEN MARY Dear amma many problem my life why ma. amma please solve my problem. continuously many problem ma my mother any save for me amma please ma. Chennai 2015-05-15
daughter Madha amma, ivlo kashthathayum thanga vechu ivlo dhooram ena vara vechathuku thanks... Madha nan evlo kashtathla irukaenu ungalala matum than purunchka mudium.. en family romba kashtapaduthu amma.. en manasu marala.. en kuttan kooda vazntha vazhkaya enala maraka mudiala... nan sammanthamae illatha yarum en life la vaenunu kaekala amma.. en manasa thottu enkooda vazhuvaenu nambika thanthtu yemathitu ponathu enala thangikavae mudiala amma.. marakavum mudiama innoruthan yethukavum mudiama romba kashtapadraen.. thaaye enala inoruthankooda santhoshama epavum vazha mudiathu. please neengalathu en manasa purunchkitu enmelayum en family melayum ulla kovatha ellam maranthu en kuttana enkooda saethu vainga.. oru kalyanam enga veetla nadakathanu en kudumpame yenguthu amma... nan niraya thapu pannirukaen.. ellathukagavum enna mannichdunga madha please... en amma ku nan ipdy oru dhrogam panniruka koodathu aana yenu theriala en manasu marala.. enala ipo ellarukum kashtam madha.. please en kuttana enkooda saethu vainga.. avana vanthu ena yethukitu kalyanam pannuna enga familyoda ungakita varuvaen amma please en vazhkaya enaku thirumpa thanga amma please.. en prayera kaelunga madha pls.. en kanneeruku bathil thanga.. nan aasapata ethuvum enaku kedachathilla.. ipo en kuttana maraka mudiama romba varshama kashtapadraen amma.. seekirama engala saethu vainga amma... en life la ini pirivae vara koodathu thaaye... en kuttan kooda lifelong santhoshama ena vazha vainga amma... please en vaenduthala niraiveti vainga amma please. nagercoil 2015-05-15
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.thankyou very much amma for the journey and camera reparing.give me government job amma.thankyou amma. varahapatnam 2015-05-15
r Thank you so much for your love and kindness amam. thank you so much for your grace. Thank you so much for taking care of me and bringing me this far. Amma, I pray that you please be with me as I defend my t today. I pray that be with me and give my confidence, power and pride. I pray that you help me remember everything and speak like a champion. I pray that you send the holy spirit to be with df, tk and gf that they may approve of my work and not cause trouble for me and make me pass. Father Lord, Lord Jesus, Holy spirit, appe, kaval malakhamre, kanyattunirappu muthappanmare, st antony appacha, st jude appacha please please please be with me today in this important day of my life. Kathu kollane mathave. Koode undayirikkename mathave. slo 2015-05-15
shinu Mother mary we thank you for all the favors recd.Help us & lead us in your way always .we pray for all mankind .Lead us in your way.Help us to get a good job for my wife .Amen Bhopal 2015-05-15
Clarence Moreira Respected Rev; Fr; please pray for our family members peace, health & financial problems be solved. Take care of all our needs.Amen. CHENNAI 2015-05-15
n please amma intercede for me please unite shobu and me in marriage please and his parents agree for early marriage please and moh/dha i clear inmy first attempt and secure a good job there and please tomorrow going to apollo hopsital please everything goes well and smooth karntaka 2015-05-15
Muthu Rajendran amma nee thaan enakku amaithiyai thara vendrum shosthirem chennai 2015-05-15
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-15
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-15
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma today my 54th birthday,I thank you ma for past 53 years giving me good health protect me from all deangers and sickness. Ma bless me more and protect me and giude me ma.Thank you ma. TRV 2015-05-15
Rohan Daniel Nair Dear Mother, I pray for peace, Inner healing and happiness. Help me begin my charity for that I always wanted to do. I am going to start sowing the seed. Help me in my endveaours. Vasai 2015-05-15
JENNIFER Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my mom good health. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension,. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness. mumbai 2015-05-15
Roche Victor Maria Doss Nandri Madhavee, Amen. Chennai 2015-05-15
Roche Victor Maria Doss Nandri Madhavee, Amen. Chennai 2015-05-15
Jaya balihar Dear mother mary thank u for all the mercy and blessings that uve showed upon us.please pray for my brother in law satyajit john who is suffering from lung cancer.He is undergoing chemotherapy in Tata memorial hospital Mumbai. Please pray for his speedy recovery.He will be goin for 4th chemotherapy on 22nd may.please pray that his all his blood tests are normal and his liver enzymes are under control. Please pray for my mother sushila bala kujur who has a ligament tear.please pray for her speedy recovery.kindly pray for my friend mini s husband mr Rajiv verma so he may get a job soon.For past one and a half year he is been without job.Family is facing financial crisis. Please pray for his entire family. Please oray for my husband David balihar and daughter Divya. Jamshedpur Jharkhand 2015-05-15
ms.leelavathi pray for my family, my husband job my job. we struggling in credits .. pray for my childrens education and health.. Family peacefull.. Please pray for us bangalore 2015-05-15
2015-05-14
r dear mother I beg you help ahmed to get his driving licence as its stuck in Dubai open some door for this request also mother help all the Algeria shipments to be cleared as the same are having some issue but they trust in you mother don't let us down jesus I soak this request of mine with your precious blood let there be no probs but all get cleared mother I beg you intercede with your son for my request help us for my tooth also I am in deep trouble heal me mother also all the sick suffering too, help me to get dental insurance as this is important for me as there are no offers everything is so expensive mother . m 2015-05-14
swetha Lord i am too disturbed due to unwanted things please lord give me your blessing to be clam and help me to over come all evils. My god is you and not the Unwanted things please lord help me . Amen Bang` 2015-05-14
Sweatha Mary.A Amma At home everyone are worried about my marriage please amma help me in getting Good Guy as soon as possible. Please Amma hear my prayers and bless me amma .Amen kar 2015-05-14
swetha Amma Please bless me to get Marry Johnson Joseph by this year. Amen k 2015-05-14
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-05-14
ra My dear Velankkanni mathave. . Please give me relief from all the physical and mental pains.i have tooth ache, musles and joints pain.One dentist made me scared . Please make me healthy.Amme..please increase my concentration and presence of mind.Thank you for hearing my requests. AMEN yr 2015-05-14
ra Ponnamme. .. my youngest daughter's exams are going to start.Please be with her to write correct answers and remember everything.Please...Please show her the right path to her future. Please protect everybody in home.Please shower blessings to us AMEN yr 2015-05-14
Reshma badker Holy mother mary i want my parents should except my love. And happily they must marry me to him. I want to enjoy my marraige. I want to marry with all the rituals and tradition. Plz mother, plz make my parents ready for my marraige with my love Badkar 2015-05-14
Reshma badker Holy mother mary i want my parents should except my love. And happily they must marry me to him. I want to enjoy my marraige. I want to marry with all the rituals and tradition. Plz mother, plz make my parents ready for my marraige with my love vasco goa 2015-05-14
r dear mother i beg you to pls help cl to get his bp lower i beg you for a miracle help us to get a house close to shcool help us mother also for cl to touch his bp and clear it from his body jesus pls i soak cl and his bp with your precious blood m 2015-05-14
2015-05-14
ak Dear mother I am going to colz tomorrow so pla Jesus save me from evilpowers on me pls Jesus mother pls pray to Jesus ....Amen g 2015-05-14
Reshma badker Oh maa. Please do my lover government job fast. He is try for govt job. He had also done all possible things. Plz giv him the govt job very soon. vasco goa 2015-05-14
J.Dominic Vijay Kumar Dear Mother Mary, please save my job and am in real problems my savior I just have two days for getting this issue solved .Today I have forwarded my resume to a company fro the DGM position with your blessing if get it will be good and its seems to professional company with good reputation it I n the industry.My friend has referred me .My savior I beg you bless me so that I can get this job. My savior today in this company am blamed for everything and I don't see this year appraisal will be good, its looks like I have been targeted to be thrown out, every where they have blamed me so much I don't have anyone's support other than your blessing and grace. I don't know my savior am trying my best to resolve these issues but everything keeps coming up every now and then. I need your blessing guidance and grace to save my job and get a better one.Tomorrow I don't know what will happen and how my day will go, still we make the payment the Bodhi tree can 't be done, incase I get job I want to handover things in good way and move out in decent way. In this welcome is very good but the exit is very bad and very humiliation and insulting .My savior please save me from getting insulted from my Boss and my MD and my team members. Please forgive my sins and forgive those who sin against us. My savior I place all my problems ,issues and pains and happiness at your feet, I believe in my prayers and rosary .Please come to me stay with me and bless me so that everything goes well with your grace. Mother Mary as committed i'll shave my head and kneel and come to your holy shrines if I get this job. In your name am ending this prayer request, O Mary virgin before childbirth keep me pure in soul and body, O Mary virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-05-14
m Holy mother..protect my father from witchcrafts suffering from 8 months.save his life and change him to surrender himself to lord.a lady want to kill him so she is doing black magic attempt by attempt..save my father.amma give us transfer to vijaywada andhra region bcs if we are here that lady will kill definitely my father.so give us transfer to a very far place from this lady's place..thnq mahboobnagar 2015-05-14
sheeba Amma,we got the report .but the opposite parties are not allow to take the wood and buil the compound wall.please help my parents and my sister.please amma when will solve the problem.l L kuwait 2015-05-14
b Dear mother I surrender my spouse, his extramarital relation, the other woman and our marriage at the feet of your son Jesus. I pray in a special way for the other woman that she may move out of this relation and our lives peacefully, safely and amicably. I pray your son Jesus touches her heart and help her to come out of this relation. Please rescue my husband from this bondage as he seeks forgiveness and wants to be free of this relation. Restore our marriage in love and fidelity. I also pray for my father-in-law that he may refrain from supporting this relation and encouraging the other woman for His selfish motives. May they realize what they are doing and discourage actions that give false hopes to the other lady. Please mother pray for us. We need the grace and mercy of your son Jesus. Amen Mumbai 2015-05-14
thavrin pillay please amma ,intercede for me that i study well and pass my 3,4,5th year of dentistry.pray that amma you protect and guide me.pray that i pass all my dentistry test .pray that i become an orthodontist.pray that i be strong and confidence.pray that my mum cindamoney pillay get healed of the breast cancer.pray that we get a healthy baby girl.baby is due in september..pray that we have good health,wealth and happiness. Johannesburg 2015-05-14
Clifford judas Serrao mother I pray for forgiveness as I hurt my fiancé and her mother saying bad words to them and criticising my fiancé on her looks , clothing , fatness and many more , I was alone in my life by ur grace mother and God Jesus Christ mercy I got this girl , who was so nice , caring , loving , humble , and many more I hurt her a lot and she and her Kim upset on me , and called off the wedding , I love her but she hates me now , I pray for me forgiveness and I pray for my fiancé too and her mom that she comes back to me of its gods will mother plz pray for me as I hurt my family to by discriminating her and insulting and pressurising and many more pray for me I ask for forgiveness of my sibs india , Goa 2015-05-14
2015-05-14
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-14
Michelle holy mother, bring my father back to his normal life, My father has got into a bad company, day by day he is getting worse and further away from us. Please help us bring him back to the normal life. god please give me my family back as in this world I have nothing other than them. Please bring my father back mother please... canada 2015-05-14
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-14
M LIMA ROSE Mother, pray for your loving grace. Bless me with a happy married life. Deliver me from my present misery. I trust in your merciful help. CHENNAI 2015-05-14
s.mary sheeba Hi iam Sheebha my mummy is suffering from fever pls pray for my mummy and daddy for good health bangalore 2015-05-14
marysheeba Hi iam Sheebha pls pray for my marriage and I am working in consultancy I am not feel satisfactory pls pray I should get good job salary should increase I this office only male candidate are working no female candidate are working only I am female candidate working working pls pray for me I should get good job and my marriage should take place this year before July thanking you bangalore 2015-05-14
vinu thomas amme mathave njanglku nee tharunna anugrahangalkum kripakalku mayi ninnodu njangal stuthikkunnu. njangalanubhavikkunna kashtathakalil ninnum durithangalil ninnum njuangale karetti tharaname ennu apekshikkunnu mathave. njangalku vendi angayude pathren thamburanodu mathyastham vahikkaname KOCHI 2015-05-14
sarita palande Praise the Lord! Mother mary please shower your blessing on my family,My husband is facing lots of problem with his health & job,Please give him a good job.shower your blessing on my children salaj & saarasi & bless my mom dad and my brother help them to clear all their debts and keep them healthy too. mumbai 2015-05-14
ANNATHURAI amma i get to a malay men from facebook name Tan sri naim then i ask for the dato ship he mail me all applation from then i also apply the form then scan to him after 3 days he scan me all the from and told me that u dato ship is approved and have to some money he sent me the bank account number i have bankin frist 11,000 second 10,000 third 15,000 total rm 36,000 he have scan me a letter said on 17/5/2015 is my resal day and on 28/5/2015 is my resiving dato title so i have inform to all my friends and family to go place on this date to recive the dato title but yesaday i went to palace to find out on 17/5/2015 how my resal there read the letter and told me you have cheated this is not a real letter from istana that time i feel very shame and very sad because i have brow money from my friend and keep my gold things to broker shop and paid for malay men,now i dont no what to tell my family and friends.then i ask the officer how to apply for dato ship the officer told me if u realy want the same title that i apply for you have to sponoser rm 350.000 to place then you can get the title amma where i am going to this much money to get the title .i can tell amma with your only mother please help to get the money to get the title then i can saw my face to all my friends now i am belafing to all my friends my dato ship date is change to next month amma please help me the title will come ture from blessing mother you are only mother can help me in my life because when ever i feel sad or any sickness i will pray to mother mary and will be ok .so this time sure mother will hear my prayes and help me.amin mother i have some sore troat pain mother bless my family and give me prayes to vist velankani this year mary mother malaysia 2015-05-14
Vailankanni Payne Our Lady thank you for the strenght & blessing which you gave for my sister to clear her debts.Thank you very much.Our lady please pour blessing on my mom for her good health.Our lady please bless my family with good health & give strenght to face watever the problems may be.shower your blessing on us.Pray for us. Mumbai 2015-05-14
Vailankanni Our lady shower your blessing on my friend vaibhav as he is facing lots of problem & debts,please show him the way to clear his debts. shower your blessing on him. mumbai 2015-05-14
Vailankanni Our lady shower your blessing on my friend vaibhav as he is facing lots of problem & debts,please show him the way to clear his debts. shower your blessing on him. mumbai 2015-05-14
stephen c Dear People Of God, I wish to thank very much Jesus, Mother Mai and you people of God for all the favours, petitions and grace granted during third week. Please pray for my safe journey tomorrow. Thank you Jesus Praise you Jesus Love you Jesus.Servant of Jesus stephen. Mumbai 2015-05-14
amali Mother, atleast today will u hear my plea. i need my life back with karti. Make him realise all his mistakes and come back to me. He spoiled my life. I cant live with someone else. I cant express this to anyone. I feel ashame of myself. Show mercy on me. give my life with him or take off my life from this nasty world. don give me this punishment of living with someone life one. better take off my life. I trust in U Mother. I am unable to come to retreat centre but i expect ur grace to hear my plea from here and i should experience the divine blessing of yours by karti coming back to me. please help me Mother. I would give testimony on his arrival back to me and our wedding. please Mother hear my plea. You have showed mercy to so many, please show ur mercy on ur child's life. I trust U Mother. Let my faith wins than my fate Mother. Mother today is my day last. pls show mercy on me. Its ur day Anthony. pls help me. Intercede to mother Mary also. Its her day too. Amen chennai 2015-05-13
Natasha Mother Vellankani please guide me in every step I take and be with me in times of my difficulties. I need your blessings as I have been struggling in need of a good job. I hope and wish that I get a good teaching job where in I applied fo, hoping to get the one which is close by. Really hope to hear from the day care centre soon. Keep all the evil eyes away from me. And punish the wicked who try to destroy my name. Pray for me Amen. UK 2015-05-13
n amma intercede for me please unite me and shobu in marriage please shobu and my parents agree for early marriage please i clear moh/dha in my first attempt and get a good job there please karntaka 2015-05-13
isabel rani என் அம்மா உடல் நிலை சரியில்லாமல் உள்ளார் அவர்கள் விரைவில் குணம் பெற வேண்டும் Trichy 2015-05-13
Isabel My mother is ill health. They need to recover quickly. Trichy 2015-05-13
ramya GANESAN mary matha enakka praybannu.. na exam clear pannanaum... intha sunday exam eruku.. na ennala mudincha alavu padipen.. matavatta ne pathuko... na entha situational erukenu unaku therium ma... NAGERCOIL 2015-05-13
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-13
Jessy Please pray for me i get stressed for small to small thing in life. please pray i want your prayers. please pray for my children education. good health and peace of mind to my husband, me, my children and family member Dubai 2015-05-13
marshal mother mary please help me to get my certiifcate please its almose 2 months still i did not recieve please help me to recieve please help me amma please help me india 2015-05-13
Claudia Dear amma ,thanks a lot for your kindness ,I am just happy that you are there to help ,thanks again for my children and keeping them healthy ,please watch over my family ,thank you . Us 2015-05-13
Resmi Finu Thank u amma for ur care and love for us..show us the right path to choose in our life..Please help us to get a good job here in canada..Atleast help finu to get a good job in a week.Strengthen us and be with us in our hardships..Request to ur son Lord Jesus to fulfill all our dreams and to lead a peaceful life here.Thanks u amma and we love you.. canada 2015-05-13
t.begin daniel My wife delivery date date may 21 th. But today admit hospital. Pls save my wife & baby. My baby heart small issue. Mary mmatha please save my baby. chennai 2015-05-13
t.begin daniel My wife delivery date date may 21 th. But today admit hospital. Pls save my wife & baby. My baby heart small issue. Mary mmatha please save my baby. chennai 2015-05-13
Reshma badker I want to get married to my lover. Mr. Dilip kudtarkar. I want my parents and my and his full family should except me. And they should happily get ready to marry me with him. Dilip must get government job, as early as possible vasco goa 2015-05-13
Sanjna Asking blessed mother to help me overcome my difficulties and pains..and show me the right path Bangalore 2015-05-13
m Holy mother..my father has been suffering from witchcrafts since 8 months done by a lady for 3 times to make him a mad man and roam on roadside secondly to get heart attack thirdly to kill him..she want death of my father at any caust.she is son anger at my father.amma save my father's life protect him from all evil spirits give him deliverence from evil bondages and black magic.she is doing for every amavasya again coming monday is amavasya we are so scared what she will do to my father what happens..amma my dads health was totally spoiled.suffering from severe gastric indigestio,vomiting,gas problem,gall stines,prostrate problrm,kner pains not sleeping during nights trembling in night.pls heal my father amma.touch him with ur miraculous power..amma also give us transfer to vijaywada take us away to a very far place from this lady's placr..if we are nearby she will kill my father amma.pls save my father's life..thnq mahboobnagar 2015-05-13
Muthu Rajendran amma kapatru shoshthirem chennai 2015-05-13
2015-05-13
SM Please pray that the mgro sale goes through immediately and that jo,laboa and crm do not give any trouble or stress and that they are humbled.Please pray that the funds need not be returned due to any obstacles and that SS and SMV have great victory and success, also tyhat the factory and apt sale happeneasily and immediately and that my trip tomu is a huge victory for me. Please pray that SS gets a new house and job immediately and that RSV and baby are safe. kk 2015-05-13
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-13
Shaleen Grace Ma,I pray that my family financial will improve and be more steady,healthy.Help appa to get a good job opportunity in university,or else help him to establish his business better,increase our family in a Wat that my parents can have a happy life without unnecessary worries.I'm sorry to ask you like this Ma but please help us and show us the lightful and successful path.We will work hard for it.Thank you for all your continuous blessings.Amen. india 2015-05-13
latika Mother, I have two major projects to turn around my life. Please bless to get both of them to me. Bless me to come to your shrine on my birthday. Hyderabad 2015-05-13
latika Holy Mother, I see that Kumar loves me unconditionally but I dont know where he is getting stopped to take next step. Please make him take next step so that we get married. Hyderabad 2015-05-13
meenu I request you to please pray for my lover his name is sunny, vadakkekuttu house, moolamattom p o, manapady kerala He is now under the treatment of liver sirosis since 25.3.14 His liver functions is not workingg now the last hope is liver Transplantation His family Now faceing the financial problems they dont have enough cash for his treatment please pray for hi thodupuzha 2015-05-13
aiko please heal my illness psoriasis.mother of health so that i can work and i can help my parent's need and i can finish my study .. Philippines,Butuan 2015-05-13
vinu thomas ethareyum dayayulla amthave angayude sankethathil odivannu angayude sahayam apekshichavaril oruvaneyum nee upekshichathai kettittilla ennu orkaname.kanyakalude rajniyaya kanyakayaye dayayulla mathave ee vishawasthil saranapettu angayude trippathathinkal njan anayunnu. vilapichu kanneer cheenthi papiyaya njan angayude dayathikathe kathukondu angaye sannithiyil nilkunnu. Avatharicha vachanathin mathave dayayulla mathave njangalude kashtathakalum durithangalum sambathika njerukkangalum veedillatha avasthayum joliyillathe avasthakalum matti tharaname ennu apekshikkunnu. KOCHI 2015-05-13
joseph pray for matthew. he is dignosed with autisum.pray for his inner healing.pray for shilby and milan. thank you. canda 2015-05-13
joseph pray for matthew. he is dignosed with autisum.pray for his inner healing.pray for shilby and milan. thank you. canda 2015-05-13
rajni mother my daughter is going to 13 and got her periodd but her is toi short she is working hard for it please give your blessing to her to gsin a goid hight please please help her its a request to a mother from a mother please please mother help her delhi 2015-05-13
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please pray that god bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house good increment good promotion good full time maid, Mother please bless my family peace n happiness, Mother please bless my dad of eternal peace. Mother please bless my mom good health. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my mom of good health mumbai 2015-05-13
J.Dominic Vijay Kumar Dear Mother Mary, WE thank you for giving us another day ,another life and another beginning, We thank you for that blessings. My savior please bless me and my family with good health, good wealth, peace of mind and protect us from all evils, dangers and accidents and please forgive our sins and forgive those who sin against us. My savior please come to my aid and save my job, name and dignity in this company ,I can only beg you and ask you save me and give me better job so that I can get out this mess and please give me strength and confidence to withstand all these problems,humilation,insults and help me over come these issues.My savior please come me stay with me and bless all my meeting issues and mails which are addressed to my MD and my boss. My savior I have deadline of 18th to complete the Bodhi tree work, please help me and protect me from all issues and please give me peace of mind and with your blessing please help me complete the Bodhi tree work which is scheduled to open on 18th of May 2015.I trust in prayer and rosary I need your blessing and grace to work hard and move out in good way rather than getting insulted. Mother Mary I need your blessings so that everything goes fine. My savior come to me bless my journey today am going to Dehradun for this AV Installation ,I know without the payments getting released how will I get this work done, please show me way for that how will get this work done ,I had committed this to my management, my savior I need your help please come to save me and my job, all this is happening just 2months prior to the appraisal, this time my appraisal will be very bad and I 100% sure ,in one way am also responsible for this and process in this company is not up to the mark. My savior I need your blessings and protection to get this work executed in good way. My savior please come to me and help me over come all this problems and please bless my relationship with my MD /my boss and all my team members and show me way for my survival and forgive me for my sins and please bless me with good health, good wealth and good job please I have applied but nothing has come through till date. I Don't know whether I'll be in this company or not by next year or after appraisal ,I need you and you know my problems ,issues and pain I go through and the way the people speak about me and my job. Please bless the IT infra structure at both the places to be safe and secured,any wok I start I start it in your name only and I need your help to over come all this problems and bless them with success and peace .My savior I leave all my problems pains and happiness to you, your right person to show me way and guide me and protect my family from all evils ,dangers and accidents. I start my day with all your blessing and grace and please am taking these papers to my procurement head and CFO ,please have this approved my savior I need this today to sorted so that I can handover this to management and come out this.My savior I need you and your blessing to keep me and my family save. I'm starting this day in your and meeting and other things in yourname.SO please be with me and protect me. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body , O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-05-13
Rohan Daniel Nair Dear Mother, Please keep me happy & full of life. Help me to enjoy this god given life to me. Heal my mental ailments and scare and make me a new man. Thanks for all your graces Mother. Regards, Rohan Daniel Nair DUbai 2015-05-13
n please intercede for me unite me and shobu in marriage and his parents and my parents agree for early marriage and i clear moh/dha in my first attempt please amma and secure a good job there and my internship in apolllo goes smoothly please karntaka 2015-05-13
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-05-13
ESTHER DEAR AMMA, NANANNU ASHIRWADISU TAHI, ILLADDIDARE NINNNA HATIRA KAREDUKO TAHI. SAKU EEE JIVANA YAKENDRE NANAGE SAHAYA MADALU YARU ILLA TAHI. NANAGE MANE KOTE ADARE SALA EGE TIRISALI HELU TAHI. AMMA SAKU TAHI EEE JIVANA NANNA MAKALA SCHOOL FEES THUMBALU ILLA TAHI. KAPADU TAHI. AMMAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA NANANNU KAI BIDABEDA TAHI. HUBLI 2015-05-13
j amma, Please bless me with a new Job. d 2015-05-13
aiko viola Mother Mary heal my husband chronic bronchitis or TB so that he can live a long lasting life together with me please bless us..and please help me to go abroad so that i can help my parents and i can finich my study please,,, Philippines,Butuan 2015-05-13
Sheeba Amma,We didn't get the plot report from the thasildhar.Please help my parents and my sister.We want positive report. Amma Please bless my family members. and bless my business. I have started today and bless my tution at Kuwait Kuwait 2015-05-13
aiko viola Mother Mary heal my husband chronic bronchitis or TB and me my severe psoriasis so that he can live a long lasting life together with me please bless us..and please help me to go abroad so that i can help my parents and i can finish my study please,,, Philippines,Butuan 2015-05-13
r dear mother open some door for me for dental problems I am suffering too much all my teeth have become loose and my gums are not working I have too much pain and abcuss in my gums all boils and infection is filled pls mother I beg you to heal me intercede with yr son for me as I soak this rquest of mine with jesus precious blood nothing is impossible unto thee mother you've never let me down hold me I need yr help for my tooth. help my mother in law my parents and all our fly members help ross to be healed help cl at his new work place open some door for transfer for his job help him to get into the accounts field from the cashier now help him to get a holiday on sat to be with the fly I beg you lord touch my kids let them not fight and let them do the house work keep the house clean touch them I beg thee help alis to leave the Pakistani boy she is friendly to open some door this girl is very small and young only you can do a miracle for my request. m 2015-05-13
Sheeba Amma,Thankyou so much...........Because we got the plot report.Thank you thank you................................. Amma,We want take that bid wood and and get approved to build the compound wall .Amma help my parents and my sister. Please Ammaaaaaaaa Kuwait 2015-05-13
Mary Ammae examinnu pass avanae njn kashtapaettathinnu aenniku phalam kittanae ammmae kaivudalllaenjn abaekshikunnu ... k 2015-05-12
Jude / Jaya Dear Mother Of Velankanni, We have been married for the past 7 years and looking for forward for our first child . We have been praying fervently for this gift of child , we approach thee for prayers and submitt our request to thee. kindly grant us this gift of a healthy child and we will visit the church with the child next year. Lord Jesus we humbly approach thee. Selangor 2015-05-12
gvj dear Mother Mary, I am totally depressed becoz of my cough and cold. i consulted three doctors they have given me dozen of medicines, but still i am feeling the same. i request and pardon your legs mother, please cure my disease soon and recover me. i am helpless mother and i am scared about my family. becoz i am the bread winner of my family. Try 2015-05-12
mamatha I get tensed very soon mathe...please control that...people will look at me ina different way....mathe after thursday...am going back to my job...management Iis very happy with my work but...that shalini shakti and nobby are not happy...please maathe..am keeping my enemies in u r court kindly make them as my friends...thayee I dont know to handle people .kindly provide me wisdom and control over my emotions...let me atleast thos year without any ego clashes....hateredness....I want few good friends...please grant me thaye...and management should love me. bangalore 2015-05-12
V.christina Dear amma o my amma ,pls pray for my famliy,amma my husband rechard leave me go ,,now i struggle my income ,,amma pls help me to settle all my trouble what i go trough.i need to take care my kids.pls show me right way,i Will forget & forgive my husband rechard mariselvam.pls change his attitude amma.mother of the world in your mercy hear my pray and pls pray for me amma & answer me .Amen malaysia 2015-05-12
Sunitha my dad and Mum should blessed with good health .....we are constructing a house for more then 2 years we were not able to finish it so we need ur help god. My self, and my sister and brother should get marry soon before that we should settle our family well what were we do there is struggle to finish it and no one like us ..some times people use us like a use and throw that gives us a bad pain so plz prayer for us to complete our house and we three should get marry by this year Thank you good for all ur support and blessings you given to us and u know what we want and when is the right time to give so we give ourselves in ur hand .Amen Chennai 2015-05-12
pS amma, please let my daughter's loan request go through without any difficulties. Please bless her for a jurney without any obstacles and let her dreams come true. Please bless her meet someone good to be her life partner. Please help me also overcome the financial difficulties and come and see you in summer. I surrender to you and please help me. canada 2015-05-12
2015-05-12
Selvi Amma,we are married for 7 years,and we are not blessed with a child.Now as there was no other option,I am undergoing IVF treatment,this IVF treatment should become a success.Amma please bless us with a child in this IVF treatment,you know we have spend lots of money,we cannot afford a second IVF cycle.Amma please bless me and my husband with our baby,you had done wonders in my life,please amma I surrender to your feet,please amma bless me with a child and relieve us from this mental agony and show us light in our life.Amma please make this IVF cycle which I am undergoing now a success.Please amma there is no other place for me to go...I completely surrender to you.Please bless us with a child. Chennai 2015-05-12
Selvi Amma,we are married for 7 years,and we are not blessed with a child.Now as there was no other option,I am undergoing IVF treatment,this IVF treatment should become a success.Amma please bless us with a child in this IVF treatment,you know we have spend lots of money,we cannot afford a second IVF cycle.Amma please bless me and my husband with our baby,you had done wonders in my life,please amma I surrender to your feet,please amma bless me with a child and relieve us from this mental agony and show us light in our life.Amma please make this IVF cycle which I am undergoing now a success.Please amma there is no other place for me to go...I completely surrender to you.Please bless us with a child. Chennai 2015-05-12
Jessie Dear Matha, You know all the hardship I am going through with my life. The problems I am facing, I have no understanding why things are happening the way they do. I am totally broken by everyone I trusted. My love, my life is tormented. The people who loved me left me and everyone I trusted turned against me. I am alone and fighting emotionally by myself. Please help me to understand and overcome this painful feeling. My heart needs peace and my life needs my love. I trust you and will come to see you as soon as I can. Thank you for everything you have given me in my life. And thank you for revealing the truth about you. I missed you all these years. I am the lost lamb...please mother save me. Canada 2015-05-12
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatunna ella budhimuttukalum vishamangalum maati saukyam tharaname...athodoopam ente jobil okke anugarhikanme sales okke nannayi konduvaruvannan mathave edayakaname..athoddopam anishchantaeium pappaudeium bussinessil okke mathave anugrahikaname..anishchante veedu pani okke nadakuvannnollo mathavinte anugrahathhhal pani okke nalla reethyil nadakuvan edayakaname..athukoodathe 21st ente licennce test aanallo nalla confidenceodu okkdu drive cheythu enikku licence kittuvan mathave anugrahikaname..athodoopam enneium ente pappa,mummy,anishchan,remiya chechieum ashima moleum thirumunnpil samarpikunnu aapathil ninnum anartgalil ninnum rogathil ninnum viduvichu kaathukolaname..Amen Dubai 2015-05-12
sasikala.j dear amma pls bless my family members and i wont get a job till this day i will trying to all places but i have dnt have any job pls bless amma to get a good job neyveli township 2015-05-12
ak Dear mother say thanks to Jesus for all Jesus pls nanu exams ani pass avayl chudu prabuva mother pls pray for my exam results nanu kasatapadanu chadivanu ipoendi ipudu nuvy chudu pls lakapoty fase chasay saktini naku prasadinchu pls mother pray to Jesus avay dava am asking all dis in d name of u r son my lord Jesus .....Amen g 2015-05-12
m Dear mother ..please save my father and protect his life from witchcrafts donr done by a lambadi lady and big team for 3 times inorder to kill my father and see his dead body..pls give deliverance to my dad from black magic and evil spirits..amma stop that lady in doing these black magic to my father.she is full anget on my father amma..his health is totally disturbed.suffering from vomiting gastric trouble gastric indigestion not sleeping during nights trembling , gall stones,prostrate gland problem, urine problem..pls heal my father amma..amma that lady is doing black maguc for every amavasya amma coming monday is amavasya we are so scared what will happen?amma stop that lady in doing these evil things to my dad..amma give us transfer to vijaywada amma to a very far from this lady's place...thnq amma mahboobnagar 2015-05-12
m Amma my right eye is blinking badly sincr morning..amma im so scared ..its a belief that if girls right eye blinks it is a sign of bad and sadness..some bad happens they say..pls stop bad things at me and my family mahboobnagar 2015-05-12
SM Please pray that SMV's Mgro property sales is completed smoothly this week with no obstacles or distresses, that J leaves today and that SS and SMV have good health and peace of mind. Please pray that my home and property are safe and that crm co-operates completely and the settlement takes place immediately and that there is no problem or stress for me. Please pray that RSV and baby are safe and healthy. AM 2015-05-12
vidhya BENEVOLENT MOTHER MARY,I thank you for all your blessings. now i beg at your feet to overcome all the obstacles around me. please unite me and dharani in marriage. we have been waiting for my parents consent.strengthen us.we are fed up with disappointment,great pressure and fear.life become painful everyday. i want dharani in my life .we have a strong desire to live together.please amma guide us and lead us with your holy blessings.protect dharani from every harm.we leave our life at your feet.we beg your mercy dear mother. vellore 2015-05-12
vinu thomas amme mathave nee njangalku cheythu thannittulla ella anugrahangalkum kripakalkumayi njangal ninne stuthikkunnu. njanglude kashatathakalilum durithangalilum sambathika njerukkangalilum joliyillaymayilum veedillatha avasthakalilum njangalude koode ninnu njangale sahayichu kathu paripalicha angayude kripaykum karunaykumayi njangal nanniyode stuthikkunnu. njangalude avasthakal mattitharaname ennu angayudode njangal thazhmayayi apekshikkunnu. KOCHI 2015-05-12
maria dsa Good morning Morther Mary forgiving wonderful day for me and others in this world and thank you very much for blessing Rajesh on his birthday and keep him in your love Mother Mary. Please Mother Mary help quintus to sell his eco car in good rate and bless quintus to work hard and start his carrier thank you Mother Mary mapusa goa 2015-05-12
mahesh Dear amma please bless my family.givegood health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-12
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-12
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my family peace n happiness. Mother please help us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my dad of eternal peace. Mother please bless my mom good health. mumbai 2015-05-12
J.Dominic Vijay Kumar Dear Mother Mary, Thank you for giving us another day and other life, please bless me and my family with good health, good wealth, peace of mind and protect us from all evils ,dangers and accidents and please forgive our sins and forgive those who sin against us. My savior please save my job, my name and my dignity in this company am in real problems and defaming position ,I don't know how long will I survive in this company and what will be my future. My savior I need you to save me protect me and give me better job so that I can still work more professionally and get a better salary, my friend has referred me to company where he is working ,but I don't know how far this will workout and I don't know will my resume suit there profile. Please my savior show me way for my survival and bless me with success ,today I was late I couldn't tell my rosary please bless this day ,my mails and my relationship with my MD and boss and all my team members to be save.I need your blessings and protection ,there are so much of problems issues in my infrastructure everyday there are problems and I need your blessing and intervention to protect my IT this is my job and I need your blessing and please save my job, my company has lost hope on me and I have been advised to get an IT audit done to prove myself. I don't know where will this end and what will be the report and I am really scared there are so many problems issues and am really tensed and I don't know what will happen. Mother Mary please come to me stay with me and save me and I need your blessing ,am in real problems ,my job is in real stake ,I dotn know here will I go if lose this job I dotn have another job for me .My savior I don't know where to go what will I do who will give me job now ,mother Mary please come to me bless all my mails, my communications and issues related to my job my name ,my savior I have so many things pending ,my MD is cheesed of with me and my Dept.,I don't have good boss she keeps insulting me and humiliating me so much am tried mother Mary ,amma please come to my aid and protect me and give me support am totally been kept out of many things and I don't what will happen ,please give me your blessings and protection ,mother Mary I have two major things pending with related to my project ,which has to be done on 18th of Monday, please bless me so that the AV work is completed on time without any issues and problems and as committed mother Mary in lieu of all this working completing I'll donate 1001 rs for your shrine. Mother Mary I know I have pending offerings which I need to complete when I got his job and if another job comes I 'll come to your shrine shave my head and kneel and come up to your holy tank. I need you and your blessing please bless this day and this week with success and prosperity. I need you to help me overcoming all my problems issues and save me from all problems ,mother Mary I don't know I keep getting chest pain to much these days, am scared ,please save my life I need your blessing and I have so much of commitments in life I need to settle my family and give them good things in life, if something happens to me what will happen to my family who will take care of them ,I have hardly any saving for them. Please my savior at least till my daughter settles down, I cant breath properly please come to me and show me way for my problems issues and this job is given by you ,please mother Mary if am going out I need to go out in good way and I am due for appraisal. My savior I need you when my problems and issues to be resovled.This year I don't know what increment or promotion I get, I don't know what is my status in this company ,I only know that am been fingered by everyone ,please give me goodhealth,I'll give ma gold heart if this pain goes off. Please bless my wife with good health, good wealth and happens ,this year i' have not even started saving I don't know how ill I clear my 3 lacs of jewels loans and saving for my future and my family's future. In your name am starting this day and this week and am going to Dehradun on Thursday evening need to complete the pending work. Please come to me help me over come all these problems and protect my daughter today she has gone for school trip please be with her and bless her so that everything goes well. O Mary my savior please my relationship with my MD who is my pay master if any problems with him will result in me losing my job. I need to good person to replace this ajay who is going out of my team ,please bless my team and make it strong so that everything goes well and all my pending approvals are cleared ,please come to me and payments towards my vendors has t be cleared without any further delay. I need you I keep telling lies to my vendors for all things and I don't know where will this land mama in deep trouble,pls save me and am ending this prayer in your name , O Mary ,virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, Every threatening danger vanishes at thy prayer. St. Anthony beloved of god and man pray for us. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-05-12
Sheeba Amma,Please help my parents and my sister to get positive land report from the thasildhar and build the compound wall around that plot and take the wood and sail it.Please Amma.... Amma please lead my children. Kuwait 2015-05-12
A Holyyyy mary..... aennntae sisterinnu nallla colllegil admission kittannae avlkku entracinnu nalla rank undakkknae..kudathae aettantae manasu mariaethrayum vaegam njanjal kannan pattanae mathavae ee apaeksha thalli kalayalllkae....kaividalllae G 2015-05-12
A Holyyyy mary..... aennntae sisterinnu nallla colllegil admission kittannae avlkku entracinnu nalla rank undakkknae..kudathae aettantae manasu mariaethrayum vaegam njanjal kannan pattanae mathavae ee apaeksha thalli kalayalllkae....kaividalllae G 2015-05-12
Rupa Thank you once again dear Mother of Good Health for having heard to my prayers of granting my mother a good test report. Please keep my mother in the best of health always. She should not suffer in any ways, healthwise or financially. Please grant her with lots of happiness, love, care and good health always. Thank you my mother, you have always helped me in my distress and I want you to be with me always to bless, protect, guide and help me in whatever I do...Amen!! Mah 2015-05-11
beena Please Please Oh my velankanni Mother my lady of Health I beg you my mother to heal my Mother Aleykutty who is unable to walk properly due to nerve damage in spine and due to injection in hip bone It is paining very severly. Please bestow your sincere warmth of mother May over her spineal pain and so she can get healing and go to church. She is fully diabetes and blood pressure. Please place this petition at the feet of Mother Mary' GUJARAT 2015-05-11
Maria Am Maria...pregnant for 8 months now..recently over the last week i had bleeding which was very less by grace of god am fine..however since than am feeling very weak,tiredness,giddiness and helpless with no enerty...please pray that am active and work well...help me god and give me strength and stamana to walk as am having lot of body pains and feeling very very weak as if i might faint and fall...pls beg you to show your mercy on me..... hyd 2015-05-11
ARVIND TOPPO MY SISTER SHASHI KIRAN IS AFFECTED SOME EVILPOWER.SHE IS AFFECT ALL FAMILY MEMEBER IN EVIL POWER. THESE EVIL PWER IS PRESSED A BOY NAME VIJAY EKKA BY HINDU CULTURE EVIL POWER.ALL FAMILY MEMBERS WERE DISTRUB. KINDLY PRAY FOR MY SISTER&FAMILY MEMBERS. THANKS bilaspur, chhattisgarh 2015-05-11
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-11
grace pls heal my mom from breast cancer...currently her cancer is increasing drastically on the right side of the chest...pls have mercy on this poor soul Grace...have mercy and strengethen her and cure her with your miracelous power god...pleae have mercy on her ...she is unable to bear the pain.she came to your door step mother...dont foresake her...have bit of mercy on her mother pls show your mercy and shower your miracle on her... hyd 2015-05-11
2015-05-11
Sherome Dear mother Mary, My sister will be starting treatment for her breast cancer this Thursday. I humbly pray for your abundant blessings and guidance to surpass all difficult times and to remain in deep sheer faith in all times to come. Thank you for being there in all times. Sri Lanka 2015-05-11
Aneesh Varghese Mother, I am settled in Dubai with my family and currently I lost my job. Please bless with me to find job immediatly to over come this situation. We already have financial obligation with Bank and my daughter is studying here. I am facing a difficult situation at this moment. Please pray for us. Dubai 2015-05-11
R dear mother I beg you for ELVYESTOR touch him and his heart mother pls let him see his parents suffering for him and let him be a strength to them, let him not trouble them for any money more and for his studies to go abroad and let him not be a free bird but take responsibility of his parents and his life too lord we soak him and his decisions with your precious blood help cl for his bp to be normal and other patients too. HELP mother also for patients who are sick and suffering too. m 2015-05-11
m Holy mother. .give my father deliverence from all witchcrafts done by a lambadi lady and her team to kill my father. She wants death of my father. She wants to see his dead body. For every amavasya trails by trails by increasing the dose she is doing black magic to my father. Again coming monday is she will repeat fr every amavasya. So we are scared amma.my father is suffering from severe gastric trouble indigestion no proper belching.not sleepinproperly trembling during nights.facing heavy stRess presure in office amma..please give him deliverence fron all evil bondages and from witchcrafts powepower.heal him amma..touch my father amma..amma also give us transfer to andhra region to a very far from this lambadi widow lady and her team.give us transfer to vijaywada amma..thnq mahboobnagar 2015-05-11
marydurai Dear matha, Pls solve my husband health and job problem. He put lot of effort in his job . But name easily goes other person. So pls help him. Thank you Matha tuticorn 2015-05-11
ak DeaR mother pls pls gve peace of mind to my mumm Pls jesus save us g 2015-05-11
rahul sharma Please help my grandfather...his situation is very critical...o holy mary bless him with health... indore 2015-05-11
Parimala My husband Kanakavel is very egoistic and he keeps abusing . He is nice but his alcohol habit is making him do this. Please pray that he becomes normal, no drinks and no ego and treats my child and me with love and care Coimbatore 2015-05-11
JULIE JOSE PLEASE PRAY FOR MY HUSBAND'S IMMIGRATION PAPERWORK THAT IT MAY BE PROCESSED FAST SO HE CAN COME TO THE USA AND WE CAN LIVE TOGETHER THE LIFE GOD BLESSED US WITH. ALSO PLEASE PRAY FOR ME THAT I MAY GET A JOB WITH BENEFITS BEFORE MY HUSBAND COMES IN WHICH I CAN EXCEL MY TALENTS. ALSO PLEASE PRAY FOR OUR FAMILIES - BOTH DADS, BOTH MOMS,MY BROTHER, MY BROTHER INLAW HIS WIFE AND CHILD. PLEASE PRAY THAT GOD BLESS MY HUSBAND AND MINE LOVE WITH A BABY. usa 2015-05-11
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless me today my birth day amma give good health and give me government job amma.bless pond amma.bless my village.thankyou amma for the journey and examination.thankyou amma. varahapatnam 2015-05-11
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-11
vinu thomas amme kanivulla nathe njangalku nee tharunna karunaykum kripaykum anugrahathinumayi njangal ninne stuthikunnu. njangale nee njangalude kashtakalathu kaipidichu nadathi njangal veenupokathiruppan njangale kathu paripalicha angayude kripaykai njangal stuthikkunnu. njangalude katshtathakalum vedanakalum njangal anubhavikkunna sambathika njerukkanagalum jolliyillaymayum veedilatha avasthakalukumayi najngalku vendi angayude puthren thamburanodu madhyastham vahikkaname amme ennu apekshikkunnu. KOCHI 2015-05-11
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries n tension, help us in our job, help us get agood house, good increment good promotion. Mother please bless my dad eternal peace. Mother please bless my family peace n happiness. MOther please free avi n me of all worries n tension. Mother please bless vi n me good health n job satisfaction. mother please bless my family. Mother please bless my mom good health mumbai 2015-05-11
Sandeep Holly Mother Mary I praying to you for getting my movement to Chennai from Riyadh for visa renewal as I can spend time with family and other important activities Thanks Chennai 2015-05-11
INACIO-JENNIFER,ROY N DYLAN PLS PRAY FOR DYLAN TO GET HIS JOB ON SHIP TO GET HIS LOST DOCUMENTS BALWANT PANDYE TO RETURN HIS MONEY BACK TGS MEET TODAY BE EXCELENT MEENA GHODE TO SANCTION LEAVE TO JENIFER INACIO TODAYS NEW JOB ASSIGNMENT BE EXCELENT N SATANI POWERS BE GOOD MARGAO 2015-05-11
Claudia Dear amme,please watch over my family and our health ,today again I have elsa mols eye check ,please mathavee let there be no inflammation or cells in her eyes ,let her hearing improve ,please help my son ,husban and myself as well as Lilly Aunty and our parents to be healthy ,amme it's all scary ,help me to have a good trip this week and be back safe ,love u amme ,hope I get to see you soon .please help!!!!! Us 2015-05-11
SASIKUMAR KRISHNA LORD MOTHER MARY SAVE ALL MY FAMILY MEMBERS FROM BAD EVIL & KEEP THEM HEALTH MOTHER MARY. AMEN SECUNDERABAD 2015-05-11
SASIKUMAR KRISHNA AMMA MARIA IM SEARCHING FOR PATNER KUMARSHASHI_99@YAHOO.CO.IN SECUNDERABAD 2015-05-11
Sheeba Amma,Please help my parents.They didn't get the plot report from thasildhar.So they are very sad.Please help my parents to get positive report from thasildhar.Please help amma.... Kuwait 2015-05-11
kavitha henry Mother mary pls have mercy on me amma soon I should go from this office amma too much debit problem amma pls help me and listen to my prayer pls cure the problem to my grandmother amma she is suffering from body pain and lot of bone pain and tried for her amma pls be with her and help her amma don't leave her hand amma pls pls be with her amma iam having lot of money problem amma 15th I have to give it to her cheat amount amma 20,000 and the interest amount 7600 amma from wer shall I go and get it amma pls tell me no baddy is there to help me amma pls be with me and help me amma Amen. Bangalore 2015-05-11
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-05-10
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless tomorrow exam and the journey.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-10
monisha catherine Ave maria.i thank mother mary for her blessings upon me and my family.As i am waiting for my 10th results on 21st May.as it is very important to get full marks.I ASK MOTHER MARY TO GIVE FULL MARKS IN ALL THE SUBJECTS.and to decide the best group to study in my school. .so i kindly ask mother mary to give knowledge for me to take the best group which will be useful in my life.and to give strength to my dad while working.and to give good health to my mom and dad and for my sister's studies & also for my personal problems.i have great faith in mother mary that she will grant our request. TAMBARAM 2015-05-10
monisha catherine Ave maria.i thank mother mary for her blessings upon me and my family.As i am waiting for my 10th results on 21st May.as it is very important to get full marks.I ASK MOTHER MARY TO GIVE FULL MARKS IN ALL THE SUBJECTS.and to decide the best group to study in my school. .so i kindly ask mother mary to give knowledge for me to take the best group which will be useful in my life.and to give strength to my dad while working.and to give good health to my mom and dad and for my sister's studies & also for my personal problems.i have great faith in mother mary that she will grant our request. TAMBARAM 2015-05-10
thavrin pillay intercede for me amma that i pass my third,fourth and fifth year of dentistry.pray i study well and write all my test to the best of my ability.pray i do well for my test on the 12 and 29 may 2015.pray that i pass and have good marks.pray for gods protection and guidance.pray for my good memory.pray for my wife shamantha that we have good health,wealth and happiness.pray for our baby.pray for my mum chinthamoney pillay who has breast cancer.pray that god restores her health.pray i get my dentisrty degree Johannesburg 2015-05-10
ak Mother thank u for u r blessings on us pls pray for us and give me peace of mind and also pls give good marks in my exams .. Amen j 2015-05-10
m Holy mother..give my father deliverence from witchcrafts and evil bondages suffering since from 8 months done by a lady for 3 times.his health was torally spoiled..not eating properly indigestion gastric trouble not sleeping during nights. .please protect my dad from witchcrafts. Protect him and save him..amma guve us transfer to andhra to a very far from this lady's place..if its ur will give is vijaywada transfer mahboobnagar 2015-05-10
hari.s mr hari from andharapradesh need of your prayers iam gratly in troubles kindly offer nine mases and pray for this intension sattenapalli 2015-05-10
hari.s mr hari from andharapradesh need of your prayers iam gratly in troubles kindly offer nine mases and pray for this intension sattenapalli 2015-05-10
leema natasha Dear mother of velankkani, I your daughter pray for my medical exam in my county srilanka, I have seen failure three times with this exams. Please help me mother reach success this time were I m sitting for the forth time this may on 18th:20th:and 21st. I promise to return to your place to thank you next year. Ave Maria.... srilanka : kandy district 2015-05-10
A Ammae aentae exminnu nannayi passavan annuvadhilkannae ammae kaividalllae nallla mrk tharannae C 2015-05-10
mahesh dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless vijaya and me for writing dsc exam you be with us help us throut the exam and the journey.bless rishika we are leaving her and going to exam bless heramma.give me govrnment job amma.bless pond amma.thankyou amma. varahapatnam 2015-05-10
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-10
AMD Mother Mary, I am feeling very depressed. I feel that I am not able to cope up with my current role in my career. Please help me to solve the problems in my workplace and make it a peaceful place for everybody to work and enjoy their life. I want to make peace with my past, please help me and bless happiness and health to all my family members Also, my husband too getting frustrated and depressed as he is not seeing any progress in career of his choice. Please help him and make him achieve success in this regard. India 2015-05-10
jancy Blessed ammae iam so sad ad depressed from my life.please pray for me.please pray for my new house which is in progress.ammae please pray for my financial problem.please pray for my job secure.pray for my husband suffering from cancer.for my son his studies.ad to find a good job ammae.amen taif saudi arabia 2015-05-10
Thevaapriyaa Amma today I have taxation exam maa. Amma my exam is at 2pm to 5pm maa. Amma I have prepared everything for this exam maa. Amma please bless me to do well in this exam maa. Amma my lecturer told me the exam questions will be tricky. Amma please bless me to get a very easy question maa. Amma please bless me to do well in this exam maa. Amma please bless me to score well in this exam maa. Amma please bless me and be with me always maa.AMEN... Malaysia 2015-05-10
rajni mother my daughter is going to 13 and got her periods but her hight is too short please mother give your blessing toher to vain agood hight atleast 5"2 please mother please please please please please pray for her please please please delhi 2015-05-10
vinu thomas amme kanivulla nathe njangalku nee dinamprethi choriyunnu anugrahangalkum kripaykumayi njangal stothram cheyyunnu. njangalude kashtavasthayilum sanbathika njerukkangalilum veedum joliyum illatha avastahyilum njangalude koode ninnu njangale kathu paripalikunnathinumayi njangal ninne nanniyode stuthikunnu. njangalnubhavikkunna durithangalil ninnum njangale karettaname amme ., njangalku vendi angayude puthren thamburanodu madhyastham vahikkaname. KOCHI 2015-05-10
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-10
Sheeba Amma,the government officers told to my father today i will give the report about the plot.Please Amma we want positive report for my father.please Amma destroy the opposite parties and the panchayat president.Please Amma help my parents and my sister .We want good news from the thasidhar .Please Amma we want to build the compound wall around my father's plot and take that big wood .Please Amma come with your son.Please amma.Please give peace,happy for me and parents and my sister. Kuwait 2015-05-10
Your devotee Mother Mary, Please find me a Business Analyst Job i have done the Training long back ago but still i cant find the right job and also iam planning to apply for Indian Visa Please get me the visa as early as possible without any trouble. secure my future Devotee USA 2015-05-10
jennifer Dear Mother, Thankyou mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child> Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house, good increment good promotion. mother please bless my dad eternal peace. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness, Mother please bless my mom good health. Mother please keep my family peaceful/ mumbai 2015-05-10
jennifer Dear Mother, Thankyou mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child> Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house, good increment good promotion. mother please bless my dad eternal peace. Mother please bless us sort our family dispute. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness, Mother please bless my mom good health. Mother please keep my family peaceful/ mumbai 2015-05-10
thavrin pillay please amma intercede for me thavrin pillay that i study well and pass my test on 12 may 2015.pray i write well and remember all that i have studied.pray i pass with good marks.thank you amma for all that you have brought into my life.pray for my good health,wealth and happiness.guide and protect me always.pray for my wife shamantha and our baby girl.pray for my mum who has breast cancer.thanks alot Johannesburg 2015-05-10
stephen c Dear People Of God, Please pray to Jesus and Mother Mai to bless all my work for this week to go smoothly and grant all my petitions which i place before you. Thank you Jesus Praise you Jesus Love you Jesus. Stephen A servant of Jesus. Mumbai 2015-05-10
J amma, I beg your powerful intercession to heal my illness and heal the foot of my son. Again i beg your powerful intercession to get a job in good company with good salary and allowance. I am not able to adjust with the present job condition. Please shower your mercy to remove all obstacles in getting the Job.Please shower your mercy. I promise, i will come to your church once granted. d 2015-05-10
rupa Thank you dear Mother of Good Health for favours granted. My prayers for the recovery of Marilyn Remedios who met with an accident and went into coma has returned back to life and this has been possible only cause of you having heard to my prayers and granted the favour. Please keep her in good health always.. Amen!! mah 2015-05-10
CLARENCE M. Our loving blessed mother please help us to clear all debts & live in peace , joy & happiness.Help me to get a job as early as possible i am in great need of your guidance & protection.please help us mother , please help us mother , please help us mother.Amen. CHENNAI 2015-05-09
n Please amma intercede for me unite me and shobu in marriage please and his parents agree for early marriage please amma my internship in apollo hospital goes smoothly and calmly pls karnataka 2015-05-09
2015-05-09
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless my pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-09
Sheeba Amma,We didn't get any good new and success news from government officers and thasidhar. we want my father has to win this land problem.Please Amma destroy the opposite parties and panchayat president also.They are always struggling my father and blackmail the government officers and police and lawyers.please Amma we want success report the thasidhar and built the compound wall around the plot. Please help........... Kuwait 2015-05-09
shinybosco myhusbantboscotrnsfarcansalmyfamilybedtopray ernakulam 2015-05-09
shinybosco myhusbantboscotrnsfarcansalmyfamilybedtopray ernakulam 2015-05-09
thavrin pillay please amma intercede for me that i study well and write my dental test on 12 may 2015 to the best of my ability.please let me pass with good marks.please give me thavrin pillay good health,wealth and happiness.pray for our baby and my wife shamantha reddy.pray for my mum who has breast cancer.open our way amma.protect and guide us.thank you amma for everything Johannesburg 2015-05-09
Kavitha Henry Mother mary amma pls have mercy on me amma ,,pls amma I would not able to solve my problem I dono what to do amma iam facing so much of problems amma I don't have money to pay my office rent also amma having lot of problems lot of credit problems amma pls pls I beg you to solve my problems amma your the only one person to solve all my problems pls help me and love me amma I dono how much to beg with every one amma so much iam begging amma I have a credit of 12 laks who's there to solve my problems amma pls tell me amma even your not helping me in any thing your leaving my hand and going away amma than how's there to help for me iam alone suffering for the money amma before aunty comes from London I should give her the golds amma pls help me and bless me amma don't leave my hand always be with me you know that I don't have any support from any one except from you so pls bless me amma has much as you can help me amma I did a business against from every one I should stand in my leg so that any problem amma I kept my leg in the front I should take my leg back amma pls you tell me your the mother and father sister every thing too me you want me to come down in my life tell me amma ,,, pls help me for the money were iam asking they should give me some amount amma pls bless me and be with me don't leave my hand amma pls pls amma pray to jesus Christ with your son that all my money problems should come down amma Amen. Bangalore 2015-05-09
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen --- 2015-05-09
AMOLORPAVAMARY MOTHER HEAL MY MOTHER'S BLADDER STONE AND HEART DISEASE. IPOH 2015-05-09
Anson AMME MATHAVE PLEASE PRAY FOR ME TO GET A PERMANENT JOB AS SOON AS POSSIBLE IN SAUDI ARABIA.PLS PRAY FOR ME. saudi 2015-05-09
Josephine Pray for us. Please fulfill our life with out child its empty our life. plse amma give me baby in our life and family . Pray for us. Nagercoil 2015-05-09
shinu Mother mary we thank you for all the favors recd.Help us & protect us from all evils .Heal us from all diseases & guide us in your way.We pray for all mankind goodness & good health.Guide them in all problem always .amen Bhopal 2015-05-09
Renuka Lakshmikanthan My mother V.T.Vijayalakshmi underwent surgery for carotid artery block on the right side of neck on 4th May 2015.Operation was successful but she had a heart attack after the operation.Right now she is under intubation on ventilator for breathing difficulty.Doctors are also saying that her heart is functioning very poorly.I pray to you Dear Mother Velankanni that her heart functions properly and she overcomes the breathing difficulty and recovers soon by your grace.Thank You. Renuka Vellore 2015-05-09
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-09
maniya paramasivam amma.i am sorry for all my bad behaviors i did so far amma. i love you amma. i need you to be with me and bless me forever amma. i love you amma. make me so so bright and clever and very very good thinking mind amma. i need you to bless me forever amma. i love you amma. i am sorry for all my bad behaviors i did so far amma. if i am so bright and very clever and very fast learning abilities and ability to anything amma. it will help me to be good and it will help me to build up confidence amma. i love you amma. i love you so much amma. i come to you and i asked you my wants and requests to you amma. i hope i got all of them amma. with your blessings maniyan paramasivam noida 2015-05-09
Jaya john Mathave please heal my husbands stomach pain. Please make him alright from the pIn he is suffering . Please mathave hear our prayer and shw mercy on us.please mother Kalyan 2015-05-09
m Holy mother. Give my father deliverence from witchcrafts and evil bondages since 8 months. His health is totally spoiled.suffering from vomiting gastric indigestion.a lady did this black magic at any cast to kill him repeatedly fr 3 times. pls save my fathers life..protect him from witchcrafts and evil bondages. amma give us transfer to vijaywada. .thnq mahboobnagar 2015-05-09
b Oh mother pray to your son Jesus to rescue my husband from the bondage of extramarital affair safely,peacefully and amicably. Pray that Jesus may bless and touch the other woman and help her to come out of this relation and move on with her life peacefully. May Jesus wash away her desire of continuing with my husband and of him marrying her. I also pray for my father-in-law that Jesus may heal him and take away his selfish motto of encouraging the other woman to continue the relation with my husband. Please Amma pray to Jesus to restore our marriage and save my husband from this bondage with His grace and mercy. Amen Mumbai 2015-05-09
v Oh mother, I beg u with all my heart plz bless shanu with a job. He is so much depressed and breaking down.plz bless him with a job.I want to c him happy.Plz I beg you bless my husband with a job. We have no house no money no children after 4 years of marraige. I know u are with me. Plz help us please. Our Lady of Vailankanni pray for us goa,mumbai 2015-05-09
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-09
MM Ma, Good Morning and thanks for all your blessings and graces you have showered on me and on my family. Ma, I humbly and urgently ask you to help my daughter and bless her and strengthen her in her forthcoming exams. please bless her with good health of mind and body and help her to retain all that she studied and excel in all her papers you correct all her papers and bless her to get full marks & bless her with good health of mind and body. ma take care of her and amma, niece, sister and us. ADH 2015-05-09
n please amma intercede for me unite me and shobu in marriage and his parents and my parents agree for early marriage please also i get leave today to go kerala and i get moh/dha in my first attempt and secure a good job there karnataka 2015-05-08
Roche Victor Maria Doss Nandri Madhavee, Thanks for traveling with us all the time .. Amen Chennai 2015-05-08
Sweatha Mary.A Amma, i have completed my degree in 2012, but i din't get a job which i prefferd but i got a job which din't satisfied by me and my family so please Amma help me in getting job as well as a become a successful women, and later there was many problems at home so please so solve all the problems. Now at home they are searching for guy please amma help me in getting best guy with your blessing. Amma helping from all the dangers and bless me with your grace i hope i will get best in my life . Amen Bangalore 2015-05-08
Sweatha Mary.A Amma, i have completed my degree in 2012, but i din't get a job which i prefferd but i got a job which din't satisfied by me and my family so please Amma help me in getting job as well as a become a successful women, and later there was many problems at home so please so solve all the problems. Now at home they are searching for guy please amma help me in getting best guy with your blessing. Amma helping from all the dangers and bless me with your grace i hope i will get best in my life . Amen Bangalore 2015-05-08
Sweatha Mary.A Amma, i have completed my degree in 2012, but i din't get a job which i prefferd but i got a job which din't satisfied by me and my family so please Amma help me in getting job as well as a become a successful women, and later there was many problems at home so please so solve all the problems. Now at home they are searching for guy please amma help me in getting best guy with your blessing. Amma helping from all the dangers and bless me with your grace i hope i will get best in my life . Amen Bangalore 2015-05-08
swetha Amma till now i have seen all the difficulties, sorrows etc..... i am fully disappointed by the things which happened in front of me please Amma I am begging you, please help me in order to overcome all the difficulties in my life and at least now on-wards i want to lead my life in happiness and i want my beloved Johnson as my life partner please amma help me by getting him as my partner. and help me to visit your place at-least by this month Amma. Karnataka 2015-05-08
thavrin pillay please pray i pass my 3rd,4th and 5th year of dentistry and obtain my dental surgery degree.pray i study well.pray on the 12 may and 29 may 2015 as i am writing exams.pray i do very well.pray for my wife shamantha she is pregnant.baby is due in september. pray for my mum chinthamoney she has breast cancer.pray for our good health,wealth and happiness.pray for mother vailankannis protection and guidance for us all.thank u Johannesburg 2015-05-08
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-05-08
Sheeba Amma please help my parents and my sistsister.amma please we want positive report from the government officers today. We are waiting the report from the officers.pofficers.we want build the compound wall around that plot.aplot.amma you must not allow the opposite parties and president to take my father property. Please am ma we are waiting. .w Kuwait 2015-05-08
Sheeba Amma please help my parents and my sistsister.amma please we want positive report from the government officers today. We are waiting the report from the officers.pofficers.we want build the compound wall around that plot.aplot.amma you must not allow the opposite parties and president to take my father property. Please am ma we are waiting. .w Kuwait 2015-05-08
khimji Deliver me from drinking liquor as I am addicted to it Mother. I am a heart patient. Daily I take medicines . Please help me to stop drinking and surrender to JESUS. Mother Mary Please touch ME GUJARAT 2015-05-08
beena Mother of Velankanni I urgently need prayers for my old mother named ALEYKUTTY who is a diabetes patient and is crying daily to heal her low spinal back pain as their nerves are pressed inside the bones. No medicine curing her PLease Mother touch her with your motherly warm touch and her On lady of HEALTH . I thank you for this miracurlous healing of pain GUJARAT 2015-05-08
Michael Austine Anscur Amma Matha, I am Michael Austine living in Dubai along with my family. I have applied for my new passport.I received that.Thank you Amma. Now pls help Matha to get employment visa stamped on my passport and come to Vocation to Tamilnadu and have medical checkup. I will come to Vailankanni along with my family. Please pray for me Amma Matha. Yours Bakhtan, Michael Austine Dubai 2015-05-08
Michael Austine Anscur Amma Matha, I am Michael Austine living in Dubai along with my family. I have applied for my new passport.I received that.Thank you Amma. Now pls help Matha to get employment visa stamped on my passport and come to Vocation to Tamilnadu and have medical checkup. I will come to Vailankanni along with my family. Please pray for me Amma Matha. Yours Bakhtan, Michael Austine Dubai 2015-05-08
Bindu Thomas Amme, My son Jithin is in 10th standard. He was studying well. But from last year he was not able to concentrate on his studies. Amme. bless my son as he can get good marks in the board exams. Amme help him to walk on the right path. always be with him. Surat 2015-05-08
V.christina O MOTHER ,MY MOTHER PLEASE PRAY FOR MY HUSBAND RECHARD MARISELVAM,PLEASE CHANGE BAD ATTITUDE BE COME GOOD MAN,HE LEAVE ME 1 YEAR READY ,DEAR AMMA PLEASE PLEASE CHANGE MY HUSBAND AND COME BACK WITH ME AND WITH MY DAUGHTER. O MOTHER OF THE WORLD IN YOUR MERCY HEAR MY PRAYER AND ANSWER ME. AMEN malaysia 2015-05-08
sm Ende Mathave Please pray for us.Mathave bless us with healthy baby soon. Mathve please intercede for us and bless us with healthy baby.Thanks Mathve for all thy grace upon us. us 2015-05-08
jayachandra. T Mother I surrender mylife to your powerful intercession, please kindly heal me and save me from all the evil powers. Mother kindly heal my stomach pain and internal pains. Mother you are the only way the truth and life.help me and save me mother amen. In the jesus mighty name i request you mother amen. Thanks mother for removing all my diseases. hyd 2015-05-08
RAMYA GANESAN pls pray for my exam jaiib... romba kastangauluku naduvua entha exann unaka therium... enna kappathu..... NAGERCOIL 2015-05-08
m Dear holy mother..my father prasadarao has been suffering from witchcrafts since 8 months done by a lambadi lady for 3 times. She wants death of my father.she wants to kill him by any means,she is doing this black magic for every amavasya with group of members..she is full anger on my dad.due to this his health was spoiled. Not sleeping properly ,trembling in sleep,body becoming warmer,heat.suffering from severe gas problem and gastric indigestion. please save my father life amma.protect him from all evil bondages, black magic powers... Amma we want transfer to a very far place from this lambadi lady to andhrà mainly vij or rajmndry.amma give us transfer as early as possible. Take us away from this place to a new one which should be very far from this lambadi Lady's place..save and protect my father's life ..heal him and give him deliverance from all evil bondages. give us transfer to farer place as early as possible.. mahboobnagar 2015-05-08
m Dear holy mother.. My marriage settlement became a big problem.. Boys father is not at all making cal and not responding us..talking as he wish ,using bad language, hurting us,talking all lies and not giving correct info to his son.blaming us,harassing and torturing us like anything. U only decide whether to go forward or step backwad....Amma pls help me ..thnq mahboobnagar 2015-05-08
ak Mother pls pray to Jesus to give me a peace of mind.... k 2015-05-08
S Dear beloved mother Mary, mother please help me, mother please save me from all the stress and tensions I am bearing now, mother as I am not feeling well I am suffering from severe fever cold cough and wheezing , mother please heal me, mother touch me and heal me , mother please have mercy and heal me , mother do miracle and heal me, heal me totally whatever bothering me, and bless me with good health peace and happiness forever , mother please come into my life now, mother your child need you please be with us always and bless us mother . Mother please heal me and bless me and all my family with good health peace and happiness forever amen,mother I beg this and I pray this in your precious name amen . bangalore 2015-05-08
S Dear beloved mother Mary, mother please help me, mother please save me from all the stress and tensions I am bearing now, mother as I am not feeling well I am suffering from severe fever cold cough and wheezing , mother please heal me, mother touch me and heal me , mother please have mercy and heal me , mother do miracle and heal me, heal me totally whatever bothering me, and bless me with good health peace and happiness forever , mother please come into my life now, mother your child need you please be with us always and bless us mother . Mother please heal me and bless me and all my family with good health peace and happiness forever amen,mother I beg this and I pray this in your precious name amen . bangalore 2015-05-08
pushpa matha, I am surrending to you and please help me to overcome my problems and have a peaceful life. also resolve all the problems for my daughter. Canada 2015-05-08
Navya Karunyavathiyaya ammae aennniku exam nalla tough ayirunnu aennikariyilla mathavae eee pravashyamsenkilum njn pass avannae ammae kathu rakshikannae nannayi padichittum aenthannu aennikithu pollae vaeunnath ammae aenniku vaendi prarthikannae aennae ksividallkae aennikarumillae.. k 2015-05-08
Sandeep Holly Mother Mary Thanks for helping me all these days. Help me in safe movement with my goods to my base branch Chennai from Saudi Thank you Chennai 2015-05-08
paulraj Mother Mary, I am planning to start a IT consulting business in USA and India may be in the future. Amma, I have choosen the following name for the company, PAZ ENIAC IT Consulting Services I request you to pray to Almighty God, your son our Lord Jesus Christ and Holy Spirit and bless this name and bless me to start the business and run the business very successfully and brilliantly. Pray for me to get all knowledge, wisdom and success for this initiation with help of Holy Spirit. Please pray for me mother mary, v\ Amen USA 2015-05-08
mini Amma. You know what's happening with me. I gave everything to My man hoping someday he will be mine. Now he is avoiding me and showing is anger on me for no reason. I know he loves me but does not want to marry me. He has agreed to marry another girl of his choice and has left me with no respect. I have lost all for him. Now I stand alone unable to leave him. Please matha help me to start a life with him in the name of love this year. Bless us we understand respect each other and are committed with love n are honest n loyal. Bless us we stay eat sleep and have a child together in the name of love. Bless UA we are there for each other n death alone separate us physically but not soul. Amen. Bangalore 2015-05-08
V.christina Dear my mother ,please pray for my husband Richard mariselam.. amma please change him and come back with me and come back with my daughter. Dear amma pls change my husband Richard mariselvam bad attitude to come good man,dear amma please pray for my family,o mother the world in your mercy hear my prayer and answer me.Amen malaysia 2015-05-08
vinu thomas amme mathave njanglku amma dinamprethi tharunna anugrahangalkai njangal ammaye stuthikkunnu. njangalude kashavasthayil njangal kathu paripalichu oru kuravum varathe njangale samrakshikunnathinayi njangal nanniyode orkunnu. njangal ippol anubhavikkunna durithangalil ninnum sambathika njerukkangalil ninnum joliyillatha avasthakalil ninnum njangalku mojanam nalkaname ennu ammayode thazhmayayi apekshikkunnu. najngalkuvendi puthren thamburanodu madhaystham vahikkaname amme. KOCHI 2015-05-08
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child> Mother please bless my dad of eternal peace. Mother please bless avi n me good health, good increment good promotion good full time maid sort family dispute. Mother please bless my family peace n happiness. Mother please bless my mom of good health. mumbai 2015-05-08
GB Blessed Mother please pray that my son Clinton may get a good internship job in Canada and that he may get his citizenship also eventually. Need prayers for my daughter also to be settled soon in life. Need a good life partner for my niece so that she too can get settled soon. Please interceed to our Lord Jesus that my husband is cured of his illness. Thank you Mother Mary. dxb 2015-05-08
Roche Victor Maria Doss Nandri Mother , Thanks for this wonderful life Amen Chennai 2015-05-08
Marian Please pray for God's protection and His blessings for Stephen, Marian, Carl, Robert and Florence. Asking this request in the Most Holy Name of Jesus. Thank you for praying and God Bless all of you. Pennsylvania USA 2015-05-08
devotee Amme,please help me... pta 2015-05-08
stephen c Dear People Of God, I thank very much Jesus, Mother Mai and you people of God for all the petitions and grace granted during this week. Pls pray to guide me safe from a office personal work today. Thank you Jesus Praise you Jesus Love you Jesus. Stephen a servant of Jesus. Mumbai 2015-05-08
rajni dear mother please pray for my daughter she is going to 13and got her piriods but her hight is too short please give your blessing to her to gain a good body hight atleast 5"2 please it is very necessary fir her please mother please please pleaseplease please please please it a request to a mother from a mother my daughter name is tisha delhi 2015-05-08
Sheeba Amma,Please help my parents and my sister for the land problem.Please protect them from opposite parties and protect my father's plot.Please Amma solve the problem today quickly.we don't want case court , fighting etc.please Amma... Kuwait 2015-05-07
jude wellness of my grand father from heart burn kothamangalam 2015-05-07
Suresh Thanks Amma for praying for us Bangalore 2015-05-07
Sheeba Amma,Please help guide my parents and my sister to solve the land problem and build the compound wall around my father's plot.Please Amma... Kuwait 2015-05-07
Sheeba Amma,Yesterday the opposite parties are not allowed to put the"elgai kallu" and take the wood .Amma please tell to the government officers to put the "elgai kallu" and solve this problem today quickly.And guide my father and my sister. Please Amma........ Kuwait 2015-05-07
n Please amma intercede for me unite me and shobu in marriage please amma and his parents and my parents agree for early marriage please amma and i clear moh/dha in my first attempt and secure a good job there in dubai or abu dhabi karnataka 2015-05-07
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.thankyou amma for velakini journey.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-07
Sheeba Amma,Please give good news ie solved the land problem from my sister. Amma i feel very sad.We want build the compound wall around my father's property.So please help my father and my sister Amma.Please Amma......................Please Amma................Solve every think today quickly Amma.Save my parents and my sister's family and the plot and the wood from opposite parties. Please Amma......I am waiting Ammma Please come with your son. Kuwait 2015-05-07
Anon Blessed Mother Mary, ever virgin, most gratefully thanking for all the favours and forgiveness above all. Praise Your Jesus, thank You Jesus. Amen. -- 2015-05-07
n Please amma intercede for me unite me and shobu in marriage and his parents agree for early marriage please u clear moh/dha in first attempt please and also pavani give her peace of mind and relieve her from all tensions and for manohars father get got stroke cure him and he stops smoking karnataka 2015-05-07
anil Our lady of health with your blessings we are happy.amma please listen your prayer and give me glory to your family.amma my brother has completed b.tech sarching for job please give your blessings to us.ameen rajampeta(a.p dist) 2015-05-07
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVASHOULDBEAVVAALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAGOTAVVAAVVACOLDAVVAAVVANDAVVAAVVACOUGHAVVAAVVAAVVAPLEASEAVVAAVVADOAVVAAVVAMIRACLEAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAANSWERINGSAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAVVAAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAANDAVVAAVVACUREAVVAALLAVVAHEALTHISSUESAVVAANDAVVAALSOAVVACUREAVVAAVVATENSIONSAVVAAVVAAVVAITRUSTAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVATHANKSAVVAAVVAFORAVVAANSWERINGSAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAAVVAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAPLEASEAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVACOLDANDCOUGHAVVAAVVAANDAVVAAVVAALSOAVVAAVVASHOULDNOTHAVEANYHEALTHPROBLEMSAVVAAVVAAVVAANDAVVAAVVASHOULDNOTHAVEANYTENSIONSAVVAAVVAVVAAVVAAVVA……AVVAAVVAAVVAAVVAMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEOURHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAANDAVVAAVVACUREHOLYMOTHERHEALTHAVVAAVVATHISWEEKAVVAAVVAOURAVVAAVVAGOINGTOAVVAAVVAHEALTHCHECKUPTOHOSPITALAVVAAVVABUTAVVAAVVAWEDONTKNOWWHICHHOSPITALAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVANDAVVAAVVAAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAAVVAHAVEMISUNDERSTOODMEAVVAAVVAAVVAAVVAPLEASEAVVAAVVARESOLVEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEOURHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURBROTHERAVVAAVVAANDOURFAMILIESWENTOAVVALORDAVVAAVVAKALASTHITEMPLEAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAUSAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURAVVAHOLYMOTHERAVVAAVVAANDAVVAMEORMYBROTHERAVVAAVVAGOINGTOHOSPITALFORAVVAOURAVVAHOLYMOTHERAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAALWAYSAVVAAVVAAVVAANDAVVAAVVAHEALTHAVVAAVVAREPORTSHOULDBEFINEAVVAAVVAWITHOUTAVVAANYPROBLEMSAVVAAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAAVVALORDAVVAAVVAKALASTHIAVVAAVVATEMPLEAVVAAVVANAGADOSHAPOOJEAVVAAVVAHAPPENEDVERYWELLAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEAVVAAVVAFINEAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAALWAYSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVASAFEGUARDAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVAANDAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVATHISWEEKAVVAAVVAPLEASEAVVAAVVABEWITHAVVAOURAVVAAVVAANDWITHUSAVVAAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAITRUSTAVVAAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAVVAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVASAFEGUARDAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVABLESSAVVAAVVAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAHAPPYAVVAAVVAVARAMAHALAKSHMIDEVIAVVAAVVAHABBAAVVAAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVAHAVEAVVAAVVAEVERYDAYMORNINGAVVACOFFEEBREAKFASTAVVAAVVAEVERYDAYAFTERNOONAVVALUNCHAVVAAVVAEVERYDAYEVENINGAVVACOFFEEAVVAAVVAEVERYDAYNIGHTAVVADINNERAVVAAVVAEVERYDAYAVVAAVVAONTIMEAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVANDAVVAAVVABABYAVVAAVVAFAMILIESAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAAVVACUREAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYBABYAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAITRUSTAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAAVVAAROGIAAVVAAVVAMAGUAVVAAVVAAROGIAAVVAAVVAAVVAAVVANAGUAVVAAVVAAVVAMAGUAVVAAVVANAGUAVVAAVVAKAPADITHGEAVVAAVVATHUMBAAVVAAVVATHANKSAVVAAVVA……AVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVATHANKSGIVINGAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYAVVAAVVABABYHEALTHAVVAAVVAHEALTHAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAFORAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAOURAVVAAVVAAVVAAROGIAAVVAAVVAAVVAMAGUVUAROGIAAVVAAVVAAVVANAGUVUAVVAAVVAAVVAMAGUNAGUVUAVVAAVVKAAPADITHGEAVVAAVVAAVVAAVVATHUMBAAVVAAVVATHANKSGIVINGAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAHELPMEAVVAAVVANOTTOGETANYERRORAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHAPPYHOLYMOTHERFEASTAVVAAVVASTARTINGFROM29THAUGUSTAVVAAVVANDAVVAAVVAHAPPYGANESHAFESTIVALAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAOURAVVAAVVABABYAVVAAVVABOYAVVAAVVAHEALTHAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAHAPPYHOLYMOTHERFEASTAVVAAVVAHAPPYHOLYGANESHAHABBAFESTIVALAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAHAPPYOURAVVAAVVAHOLYMOTHERAVVAAVVABIRTHDAYAVVAAVVAANDAVVAAVVAHAPPYAVVAAVVAHOLYMOTHERAVVAAVVAFEASTAVVAAVVAPLEASEHELPMETOGOTOAVVAAVVAHOLYMOTHERCHURCHBY3.30PMTODAYAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAIAVVAMISSAVVAOURAVVAAVVAAVVATODAYAVVAISGOINGTOSTOMACHSCANNINGAVVAAVVAAVVAANDAVVAAGAINAVVAAVVAANDWEAVVAAVVAGOINGONSATURDAYAVVAAVVAFORHEALTHREPORTRESULTSAVVAAVVAAVVAPLEASEAVVABEWITHAVVAAVVAAVVAANDWITHUSAVVAAVVAANDAVVAAVVADOMIRACLESAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVATOMORROWAVVAAVVAOURAVVAAVVAANDAVVAAVVAMEGOINGTOAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAPLEASEBEWITHUSAVVAAVVAAVVAHEALTHREPORTSHOULDBEFINEWITHOUTANYHEALTHISSUESAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAGAINAVVAAVVAOURAVVAAVVAANDMEAVVAAVVAGOINGTOHOSPITALONTHISSATURDAYAVVAAVVAAVVAOURAVVAAVVAFORHEALTHCHECKUPAVVAAVVAPLEASEAVVAAVVABEWITHAVVAOURAVVAAVVAAVVAANDAVVAAVVAWITHUSAVVAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAAVVAHEALTHREPORTAVVAAVVAANDAAVVAAVVAOURAVVAAVVAHEALTHSHOULDBEFINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAANDAVVAHELPAVVAAVVAAVVAINHOSPITALAVVAAVVAANDAVVAAVVABEWITHAVVAAVVAAANDAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVATHYROIDAVVAAVVAPROBLEMAVVAAVVAAVVANDAVVAAVVAINEVERYTHINGAVVAAVVAALWAYSAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHANKSGIVINGAVVAAVVAFORAVVAAVVAANSWERINGOURPRAYERSAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVASRIANJANEYASWAMYAVVAAVVACARFESTVIALAVVAAVVAAVVAAVVAHAPPYAVVAAVVAHOLYAVVAAVVAVIJAYADASHAMIFESTIVALAVVAAVVAAVVAANDAVVAAVVABLESSAVVAAVVAOURAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAWITHAVVAAVVALOTSOFAVVAAVVAHAPPINESSAVVAAVVAAVVAPLEASEAVVAAVVAHAVEEVERYDAYMORNINGAVVAAVVAHAVEAVVAAVVABREAKFASTANDCOFFEEAVVAAVVAAVVAEVERYDAYAVVAAVVAAFTERNOONAVVAAVVAHAVEAVVAAVVALUNCHAVVAAVVAAVVAEVERYDAYEVENINGAVVAAVVAHAVEAVVAAVVACOFFEEORTEAAVVAAVVAAVVAAVVAAVVAEVERYDAYNIGHTAVVAAVVAHAVEAVVAAVVADINNERAVVAAVVAAVVAONTIMEAVVAAVVAAVVAEVERYDAYAVVAAVVAAVVAWITHOUTMISSINGANYDAYAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVAAVVAAVVATOMORROWAVVAAVVAANDAVVAOURAVVAAVVAANDMEAVVAAVVAGOINGTOHOSPITALAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAOURAVVAAVVAANDAVVAWITHUSAVVAAVVAAVVAANDAVVAAVVAGUDEAVVAOURAVVAAVVAAVVAFORAVVAAVVAOURAVVAAVVAHEALTHREPORTCHECKUPAVVAAVVAAVVAOURAVVAAVVAHEALTHSHOULDBEFINEANDGOODAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPTODAYAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAOURAVVAAVVAAVVANDAVVAAVVAGUIDEUSAVVAAVVAAVVAAVVANDAVVAAVVAWITHMYBROTHERAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAPLEASEBLESSAVVAAVVAOURATHEAVVAMUDAMMASOULAVVAAVVAANDAVVAAVVABLESSAVVAAVVATHEIRFAMILIESAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMMAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVAAHOLYMOTHERAVVAAVVATHANKSAVVAAVVAFORANSWERINGAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAOURAVVAAVVAHEALTHAVVAAVVAISFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAOURAVVAAVVAHEALTHREPORTISALSOFINEAVVAAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAOURAVVAAVVANEIGHBOURAVVAAVVAGRANDMOTHEREXPIREDAVVAAVVAAVVAPLEASEAVVAGIVEAVVAAVVAPEACETOAVVAVVAGRANDMOTHERAVVASOULAVVAAVVAAVVAANDAVVAAVVAHELPAVVAAVVATHEIRFAMILIESAVVAAVVAAVVAFROMAVVAAVVAOCTOBER14THTUESDAYAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVAPOOJEISSTARTINGAVVAAVVAAVVAANDON18THOCTOBERSATURDAYCARFESTIVALAVVAAVVAAVVAOURAVVAAVVAOURAVVAHOLYLORDAVVAAVVASRIANJANEYASWAMYAVVAAVVACARFESTIVALSHOULDCOMEWELLAVVAAVVAANDAVVAAVVAGUIDEUSWITHOUTPROBLEMSAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVASHOULDNOTRAINNEXTWEEKAVVAAVVAAVVAAVVAANDAVVADOMNICANDTHIERFAMILIESCOMINGTOAVVAAVVAOURAVVAHOLYAVVAAVVAVELANKANNIAVVAAVVACHURCHAVVAAVVAPLEASEGUIDETHEMAVVAAVVAAVVAAVVAAVVAPLEASEHELPMYOFFICEPROJECTAVVAAVVAAVVANDAVVAAVVAAVVABEWTHUSINEVERTHINGAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAANDAVVAAVVAMEAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMMAMAATHETHAAYIAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVATODAYFIRSTDAYAVVAAVVAANDAVVAAVVATILLAVVASATURDAYAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAPOOJEAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVATHISAVVAAVVASATURDAYAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVACARCHARIOTAVVAAVVACARFESTIVALAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAITSHOULDNOTAVVAAVVARAINAVVAAVVATHISWEEKAVVAAVVAANDAVVAAVVANEXTWEEKAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAFORAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVACAMEOUTVERYWELLAVVAAVVAAVVAANDAVVAAVVABLESSINGAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAANDAVVAAVVAALSOAVVAAVVAOURSINSAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYSTATUEAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYSTATUESHOULDBEFINEAVVAAVVAANDAVVAAVVASHOULDBEBEAUTIFULAVVAAVVAAVVAAVVAPLEASEAVVASHOULDNOTHAPPENANYDAMAGEAVVAAVVAPLEASEAVVAAVVALOOKAFTERAVVAAVVAANDAVVAAVVADOSOMEMIRACLESAVVAAVVAAVVAAVVADAILYPOOJEAVVAAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYPALLAKIAVVAAVVASHOULDBEFINEAVVAAVVANDAVVAAVVASHOULDBEAVVAAVVABEAUTIFULAVVAAVVAANDAVVAAVVAHOLYLORDARIANJANEYASWAMYAVVAAVVAAVVASHOULDBEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………..AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAOURAVVAAVVAAVVAPALLAKKIAVVAAVVAAVVATOMORROWAVVAAVVAANDAVVAAVVAOURAVVAAVVAAVVASHOULDNOTHAVEANYPROBLEMSAVVAAVVAANDAVVAAVVAGUIDEUSAVVAAVVAAVVAAVVAMANASAMADEAVVAAVVAMADEVOMITAVVAAVVAANDITWASINLITTLEREDAVVAAVVAPLEASEAVVAAVVABLESSOURAVVAHOLYBABYAVVAAVVAAVVAANDAVVAAVVAMANASAAVVAAVVAAVVAISHOULDNOTGETANYERRORINPROCESSAVVAAVVAAVVAPLEASEAVVAAVVABLESSMEAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAOURAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAVVAAVVAHAPPYAVVAAVVADEEPAVALIAVVAAVVAAVVAAVVATHANKSAVVAAVVAAVVAFORANSWERINGAVVAAVVAPRAYERSAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSWAMYANJANEYAAVVAAVVAGODAVVAAVVACHARIOTAVVAAVVAAVVAWASBEAUTIFULAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSWAMYANJANEYAAVVAAVVAAVVABALAAVVAAVVAHAVINGAVVAAVVASOMECRACKAVVAAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAPERMANENTLYAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAMANASAAVVAAVVASHOULDHAVVAAVVANORMALDELIVERYAVVAAVVAAVVAWITHAVVAAVVAAVVABLESSINGSOFAVVAAVVABABYBOYAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYAVVAAVVABALIPANDAMIAVVAAVVAAVVAAVVATHISSUNDAYAVVAAVVAMANASAAVVAAVVAISGOINGTOHERHOUSEAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMANASAAVVAAVVAWITHAVVAAVVABABYAVVAAVVABOYAVVAAVVAAVVAWITHAVVAAVVAAVVANORMALAVVAAVVADELIVERYAVVAAVVAAVVATHISSUNDAYAVVAAVVAAVVASENDINGAVVAAVVAMANASAAVVAAVVAFUNCTIONSHOULDHAPPENBEAUTIFULAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAISHOULDNOTGETANYERRORINPROCESSAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAMEAVVAAVVATODOAVVAAVVAAVVASOMEMIRACLEPROJECTAVVAAVVAANDAVVAAVVADEVELOPANDLEARNAVVAAVVAINTECHNICALTRAININGSAVVAAVVAAVVADOAVVAAVVASOMEMIRACLEAVVAAVVAAVVAMIRACLEAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVAMANASAAVVAAVVAANDAVVAAVVAAVVAOURAVVAAVVAAVVABABYAVVAAVVABOYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAPPAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVASISTERROHINIMARRIAGETOMORROWAVVAAVVANDAVVAWEDNESDAYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVABLESSAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYLORDAVVAAVVASRIANJANEYASWAMYGODAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAAVVAAVVABLESSAVVAAVVAANDAVVAAVVAAVVAAVVACUREAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVAAVVASTATUEAVVAAVVAAVVAAVVAPLEASEAVVAAVVAHELPMETOGOTOAVVAAVVAHOLYPLACEAVVAAVVAMANTHRALAYAAVVAAVVATOMORROWAVVAAVVAMORNINGAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAMANASAAVVAAVVAAVVAAVVATOGIVEBIRTHTOAVVAAVVAHOLYBABYAVVAAVVABOYAVVAAVVAAVVAAVVAWITHNORMALDELIVERYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVASISTERROHINIANDAVVAAVVAHERHUSBANDAVVAAVVAVINODHKUMARAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVABROTHERAVVAAVVATOGETGOODGIRLAVVAAVVAFORHISMARRIAGEAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAROGIAAMMAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……....AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVATOGIVEAVVAAVVABIRTHAVVAAVVATOHOLYBABYAVVAAVVABOYAVVAAVVAWITHAVVAAVVANORMALDELIVERYAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMAHESHAVVAAVVAHOLYBABYAVVAAVVAGIRLAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYAVVAAVVAHOLYLORDHANUMANSRIANJANEYASWAMYAVVAAVVAAVVAJAYANTHIAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAHOLYMOTHERAVVAAVVHEALTHAVVAAVVAALWAYSAVVAAVVAAVVAAVVAAVVAWITHAVVAAVVAOURAVVAAVVAGRACEAVVAAVVAANDAVVAAVVABLESSINGSAVVAAVVAMEAVVAAVVAANDAVVAAVVAMYWIFEMANASAAVVAAVVABLESSEDAVVAAVVAWITHAVVAHOLYBABYGIRLAVVAAVVAONAVVAAVVAAVVASATURDAYAVVAAVVAAVVANOVEMBER15THAT1.12PMAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAHOLYBABYNAMEISAVVAAVVAMANASVINIAVVAAVVAANDAVVAAVVAMARIAMARYAVVAAVVAAVVAANDAVVAAVVAAVVAINFUTUREAVVAAVVAAVVAWITHAVVAAVVAHOLYMOTHERAVVAAVVABLESSINGSAVVAAVVAANDAVVAAVVAAVVAHOLYMOTHERAVVAAVVAGRACEAVVAAVVAAVVAMYAVVAAVVAANDAVVAAVVAMYWIFEAVVAAVVAAVVASECONDHOLYBABYNAMEISAVVAAVVAAVVAHOLYLORDMASHAALLAHHOLYLORDSUBRAMANYASWAMYAVVAAVVAHOLYLORDINFANTJESUSAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAPLEASEBLESSAVVAAVVAMEAVVAAVVAANDAVVAMYWIFEMANASAAVVAAVVAWITHAVVAAVVASECONDCHILDAVVAAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAYESTERDAYBONUSREVIEWGOTOVERAVVAAVVAIGOT460000ANDAVVAAVVASPRATINGAVVAAVVANEXTMONTHAVVAAVVAMYDESIGNATIONAVVAAVVAANDAVVAAVVASALARYCORRECTIONAVVAAVVASHOULDHAPPENAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAMEAVVAAVVATOLEARNAVVAAVVATECHNICALKNOWLEDGELIKESCRIPTINGAVVAAVVAANDAVVAISHOULDNOTGETANYPROCESSERRORAVVAAVVAANDAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAGOINGFORWARDAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAVVAHOLYMOTHERAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPONCOMINGMONDAYAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAANDAVVAGUIDEUSAVVAAVVAAVVAHEALTHREPORTSHOULDBEFINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVACHESTPAINAVVAAVVALEGPAINAVVAAVVATIREDNESSAVVAAVVATHROATPAINAVVAAVVAANDAVVAAVVACOUGHAVVAAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAANDAVVAAVVAOURSINSAVVAAVVAWHATALLWEDIDAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYMERRYCHRISTMASAVVAAVVAAVVAHAPPYNEWYEARAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAANDAVVAAVVAMEAVVAAVVAISGOINGTOHOSPITALHOMEOHEALTHCAREINTERNATIONALAVVAAVVATOMORROWAVVAAVVAWEDNESDAYAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHREPORTAVVAAVVAAVVASHOULDBEFINEAVVAAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAAVVADOAVVAAVVASOMEMIRACLEAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEAVVAAVVAHOLYTHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVABEWITHAVVAOURAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAOURAVVAAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAAVVATHROATPAINAVVAAVVAAVVAOURAVVAAVVAHOLYMIRACLEAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEHOLYTHAAYIHOLYAVEMARIAHOLYTHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA…......AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAALLAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHROATPAINAVVAAVVAAVVAALLAVVAAVVAAVVAOURAVVAVVAAVVAHOLYMORTHERAVVAAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……… AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAThe Prayer to the Sacred HeartAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA Oh Lord Jesus Christ, to Your most Sacred Heart I confide this intention { AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHAPPYNEWYEARAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMANJUAVVAAVVAFAMILYAVVAAVVAANDAVVAAVVAHISAVVAAVVAFATHERSOULAVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAALLHEALTHTESTBLOODTESTTHROATTESTAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYAVVAAVVAALLHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAOURAVVAAVVADOAVVAAVVAMIRACLESAVVAAVVAINAVVAAVVAOURAVVAAVVAFAMILIESAVVAAVVAAVVAPLEASEICANTAVVAAVVASEESTRUGGLINGHEALTHPROBLEMSAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAOURAVVAAVVAHELPAVVAAVVAOURAVVAAVVAHOLYMOTHERTOGOTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVACUREAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAHOLYMOTHERHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAOURAVVAAVVAANDAVVAAVVAMEAVVAAVVAOURAVVAAVVABROTHERAVVAAVVAGOTOHOSPITALAVVAAVVAFORAVVAAVVAOURAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAPLEASEAVVAAVVAGUIDEAVVAAVVAOURAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHREPORTSSAVVAAVVAHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAEVILSPRIRTAVVAAVVAANDAVVAAVVAALSOAVVAAVVAINMYHOMEAVVAAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………}. Only look upon me, then do what Your love inspires. Let Your Sacred Heart decide. I count on You. I trust in You. I throw myself on Your mercy. Lord Jesus, You will not fail me. Sacred Heart of Jesus, I trust in You. Sacred Heart of Jesus, I believe in Your love for me. Sacred Heart of Jesus, Your kingdom come. Sacred Heart of Jesus, I have asked You for many favors, but I earnestly implore this one. Take it, place it in Your open Heart.When the Eternal Father looks upon it, He will see it covered with Your Precious Blood. It will be no longer my prayer, but Yours, Jesus. Sacred Heart of Jesus, I place all my trust in You. Let me not be disappointed. Amen.AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAVVAHEALTHREPORTSSHOULDBEFIINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHEMOREYOUHONOURMETHEMOREIWILLBLESSYOUAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAALLAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……....AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVATODAYAVVAAVVAWITHAVVAAVVAMYBROTHERAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHISSUESAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAIAVVAAVVAAVVATRUSTAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVAIBEGAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAANDAVVAAVVAMEAVVAAVVAISGOINGTOHOSPITALAVVAAVVAONMONDAYAVVAAVVAAVVAFORAVVAAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVACHECKUPAVVAAVVAAVVAPLEASEAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAVVAAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTAVVAAVVAAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVADOCTORSHOULDPRESCRIBEAVVAAVVAPROTEINSAVVAAVVAAVVAANDAVVAAVVAAVVAVITAMINSAVVAAVVATABLETSAVVAAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAITRUSTAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHEVELANKANNIAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHROATAVVAAVVAAVVAPAINAVVAAVVAAVVAANDAVVAAVVAAVVAPROBLEMSAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVABROTHERAVVAAVVAAVVAMARRIAGEAVVAAVVAAVVAGOTFIXEDAVVAAVVAAVVAAVVAMARRIAGEAVVAAVVAAVVAISONAVVAAVVAAVVAJUNE11THAVVAAVVAAVVAANDAVVAAVVAAVVAJUNE12THAVVAAVVAAVVAAVVAPLEASEAVVAVVAAVVABLESSAVVAAVVAAVVAMEAVVAAVVAWITHAVVAAVVAAVVAHOLYAVVAAVVAAVVABABYBOYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAFORAVVAAVVAAVVAGIVINGAVVAAVVAAVVABEAUTIFULCUTEAVVAAVVAAVVABABYGIRLAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAMMATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……… Bangalore 2015-05-07
Vinod M. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVA……AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVA……AVVAPLEASEFORGIVEMYSINSAVVA…… AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAFORBLESSINGSAVVA……AVVAILOVEYOUAVVA…… AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAWISHYOUAVERYHAPPYMERRYCHRISTMASAVVA……AVVATHANKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVVA……AVVAPLEASEHELPANDCUREOURAVVAHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA…… AVVABLESS OUR AVVAHOLYMOTHERAVVA WITH GOOD HEALTH AND WITH LOTS OF HAPPINESSAVVA……AVVAPLEASE FORGIVE MY SINS AVVA……AVVAILOVEAVVAHOLYMOTHERMARYAVVA………AVVATHANKYOUSOMUCHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAHOLYMOTHERMARYAVVABIRTHDAYAVVAAVVAPLEASEBLESSAVVAGOODHEALTHAVVAANDAVVALOTSOFHAPPINESSAVVA……AVVATHANKAVVAFORBLESSINGSAVVA…….AVVAPLEASETAKEMETOHOLYVELANKANNICHURCHAVVA…….AVVATHANKSAVVAAVVAILOVEAVVA……AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAHAPPYNEWYEARAVVAGANESHAALLAHJESUSAPPAAVVA…….AVVABLESSOURFAMILIESWITHGOODHEALTHAVVA……AVVAILOVEAVVA…….. AVVAILOEAVVAJESUSAPPAGANESHAAPPAALLAHAPPAAVVA……AVVAILOVEAVVAHOLYMOTHERAVVA……AVVAPLEASEHELPMEAVVATHESETEAMMATESTROUBLINGME AVVA……. AVVAHOLYMOTHERMARYAVVA PLEASE HELP ME TO GET MARRY WITH MANASA AVVA WITH ALL HOROSCOPE MATCHING AVVAHOLYMOTHERMARYAVVAAVVAENGAGEMENT IS FIXEDAVVA ON FEB 13 2013 AND MARRIAGEAVVAONJUNE 2ND AND 3RD 2013AVVA……AVVATHANKYOUAVVA FOR THE HELP AVVA……AVVAPLEASE FORGIVE MY SINS AVVA…….AVVATHANKYOUAVVA……AVVAILOVEYOUAVVA…….AVVATHANKYOUAVVA AVVATHANKAVVA AVVA BLESSINGS AVVA AVVAMANASA CAME HOROSCOPE MATCHING GOOD WITH MEAVVA…….AVVATHANKYOUFORANSWERING OUR PRAYERSAVVAAVVAILOVEAVVA……AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKAVVAFORCURINGHOLYMOTHERHEALTHAVVAAVVALOVEAVVA……AVVATHANKSAVVA……AVVAPLEASECUREAVVAHEALTHAVVAAVVAPLEASEBLESSOURAVVAWITHGOODHEALTHAVVA……..AVVATHANKYOUAVVAFORAVVABLESSINGSWITHGOODHEALTHAVVALOVEAVVA…….AVVATHANKSFORANSWERINGOURPRAYERSAVVA……AVVALOVEAVVA……AVVATHANKSAVVAFORBLESSINGSOURAVVAHEALTHAVVA……AVVALOVEAVVA……AVVAHAPPYUGADIANDHAPPYNEWYEARAVVA……AVVABLESSAVVAWITHGOODHEALTHAVVA……..AVVAWISHUSAVVA…….AVVATHANKAVVA……AVVALOVEAVVA……AVVAHAPPYBIRTHDAYAVVA……AVVAILOVEAVVA…….AVVAPLEASETAKEGOODCAREOFAVVAHEALTHAVVA……AVVATHANKSGIVINGAVVA……AVVAILOVEAVVA…… AVVAHOLYMOTHERAVVAPLEASECUREAVVAHEALTHAVVAPLEASEAVVABLESSMOTHERWITHGOODHEALTHANDHAPPYAVVA……AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVACUREAVVAHEALTHAVVAHOLYMOTHERAVVA…… AVVATHAKYOUAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVALOVEAVVA……AVVAPLEASEAVVA AVVACUREAVVAAVVAHEALTHAVVAANDAVVABLESSOURAVVAGOODHEALTHAVVA……AVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEYOUAVVA……AVVATHANKSAVVAAVVABLESSINGOURHOLYMOTHERHEALTHAVVA……AVVAILOVEYOUAVVA……AVVAFLAGHOISTINGSHOULDGOWELLAVVA…….AVVAIAMSORRYAVVAAVVAHAPPYNEWYEARAVVAEVERYYEARAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAANDBLESSOURNEIGHBOURSFAMILIESAVVA……AVVAIHAVEJOINEDINFORMATIONSECURITYTEAMAVVAAVVAWITHAVVABLESSINGSAVVAON23/12/2013AVVAAVVAPLEASEHELPMETOLEARNALLREQUESTSTYPESOFGROUP1,2,3AVVAAVVAWITHOUTERRORAVVA……AVVAILOVEAVEMARIAHOLYMOTHERAVVA……AVVAILOVEAVVAAVVAIAMSORYYAVVA……AVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA……AVVAHOLYMOTHERAVVAISGOINGTOHOSPITALAVVAAVVAPLEASEAVVAHOLYMOTHERHEALTHSHOULDBEFINEWITHOUTANYPROBLEMAVVA……AVVAILOVAAVVAAVVAMYBROTHERRAJUSHOULDGETMARRYRAGINIAVVA……AVVAMANASAMYWIFESHOULDGIVEBIRTHTOBABYBOYAVVA……AVVATHANKSAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVVA……AVVABLESSALLOURFAMILIESAVVA……AVVAILOVEAVVA……AVVAAVEMARIAAVVAAVVAPLEASECUREAVVAHOLYMOTHERHEALTHAVVA…..AVVAISGOINGTOHEALTHCHECKUPPLEASEAVVAHEALTHREPORTSHOULDBEWITHOUTANYPROBLEMAVVAPLEASEAVVAIBEGAVVAAVVAPLEASEDOMIRACLEAVVAAROGIAMATHETHAYIAVVA……AVVAPLEASEavvaBLESSOURHOLYMOTHERHEALTHAVVAILOVEAVVA…..AVVAAVEMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURHOLYMOTHERHEALTHAVVAAVVAHEALTHCHECKUPREPORTCAMEWIHOUTANYPROBLEMAVVA……AVVATHANKAVVAANSWERINGOURPRAYERSAVVAAVVACONTINUETOBLESSOURALLAVVAMOTHERHEALTHAVVAAVVAOURHOLYMOTHERFEELINGTIREDAVVAAVVAPLEASECUREALLHEALTHPROBLEMSAVVA……AVVAAVEMARIAAVVAAVVAILOVEAVVA……AVVAAVEAMARIAAVVAAVVAILOVEAVVAAVVATHANKAVVABLESSINGOURAVVAHOLYMOTHERHEALTHAVVAAVVAPLEASECONTINUETOBLESSOURAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASEHELPMYFRIENDMANJUTOGETMARRYGOODGIRLAVVA……AVVAMANASAGOTALLERGYAVVAAVVAPLEASECUREAVVAAVVAILOVEAVVAAVVAPLEASEAVVAHELPMANASATOGIVEBIRTHTOBABYBOYAVVA……AVVARAJUHELPTOGETMARRYRAGINIAVVA……AVVAILOVEAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERS……AVVAAVVAHAILMARYAVVA……AVVAPLEASEBLESSAVVAWITHGOODSTRENGTHAVVAAVVAILOVEAVVA……AVVAAVEMARIAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAPLEASEBLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVATHANKAVVA……AVVARAGINIGIRLSIDEISCOMINGOURHOMETODAYANDONSUNDAYAVVAAVVAPLEASETHEYNEEDTOACCEPTOURHOMEAVVAAVVAILOVEAVVAAVVAMYPROJECTSHOULDCOMPLETEAVVAAAVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAAVVAISMYHEARTAVVA……AVVAILOVEAVVAAVVAAVEMARIAAVVAAVVAPLEASEBLESSOURAVVAAVVAHOLYMOTHERHEALTHAVVA……AVVAPLEASERAGINISHOULDGETMARRYMYBROTHERRAJUAVVA……AVVAILOVEAVVA……AVVAMYWIFEMANASASHOULDGERCONCEIVEAVVA……AVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVA……AVVAILOVEHOLYMOTHERAVVAMYPROJECTSHOULDGETCOMPLETETODAYAVVA……AVVAILOVEAVVAAVVAHOLYMOTHERAVVA……AVVAILOVEAVVAHOLYMOTHERAVVAAVVAIAMSORRYAVVAAVVAIIDNTCOMETOCHURCHAVVA……AVVALEASEFORGIVEMEAVVA……AVVAAVVABLLESSOURAVVAHOLYMOTHERHEALTHAVVAAVVAMANASASHOULDCONCEIVEAVVA……AVVAILOVEAVVAAVEMARIAHOLYTHAAYIAVVA……AVVAAVEMARIAAROGIAMAATHETHAAYIAVVATHANKAVVAAVVAFORBLESSINGOURHOLYMOTHERHEALTHAVVAAVVACONTINUETOBLESSAVVAAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVARAJUANDRAGINIMARRIAGEGOTFIXEDAVVAAVVATHANKAVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKHOLYMOTHERAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVA……AVVAAVEMARIAAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAILOVEAVVAWITHPUREHEARTAVVA……AVVAILOVEAVEMARIAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAHOLYAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAILOVEAVVAAVVAPLEASEBLESSOURALLAVVAAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAISCONCEIVEDAVVAAVVATHANKAVVAAVVAFORBLESSINGSAAVVAAVVAMANASAGIVEBIRTHTOBABYBOYAVVAAVVAAVVARAJUSHOULDGETMARRYRAGINIAVVAAVVATHANKAVVAAVVAFORANSWERINGOURPRAYERSAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAPROJECTSHOULDCOMPLETEWITOUTANYISSUESAVVAVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVEMARIAAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYUGADIAVVAAVVAHOLYTHAAYIAVEMARIAVVAAVVA……AVVAILOVEAVVAAVVAAVVABLESSALLOURHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVA……AVVAILOVEAVVAAVVAAVVAOURHOLYMOTHERGOTCHESTANDSHOULDERBACKPAINAVVAAVVAPLEASECUREAVVAAVVAAVVABLESSOURAVVAALLOURHOLYMOTHERHEALTHAVVA……AVVAILOVEAVVAFROMMYPUREHEARTAVVAAVVATHANKSGIVINGAVVAAVVAAVEAROGIAMAATHETHAAYIAVVAAVVAFORBLESSINGSOURHOLYHEALTHAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVA…..AVVAAVVAILOVEAVVAAVVAAVVAPLEASEBLESSALLOURAVVAAVVAALLHEALTHISSUESAVVAAVVATHANKSAVVAAVVAFORANSWERINGOURPRAYERSAAVVA……AVVAMANASAISCONCEIVEDAVVAANDRAJUMARRIAGEGOTFIXEDWITHRAGINIAVVAAVVATHANKAVVAFORAVVAANSWERNGOURPRAYERS……AVVAILOVEAVVAAVEMARIAHOLYAROGIAMAATHETHAAYIAVVA……AVVAAVVAHOLYAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEHOLYMOTHERTHAAYIAVVAAVVA……AVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAPLEASECUREAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAVVAAVVAILOVEAVVAAVVA……AVVAAVVARAJUANNDRAGINIMARRIAGEALMOSTFIXEDAVVAAVVATHANKAVVAAVVAAVVAHOLYAVVAMANASAISCONCEIVEDAVVAAVVAPLEASEAVVAAVVAMANASASHOULDGIVEBIRTHTOBABYBOYAVVAAVVATHANKAVVAFORANSWERINGSOURPRAYERSAVVAAVVAHOLYAVVA……AVVAHOLYTHAAYIAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVAALLOURHOLYMOTHERAVVAHEALTHPROBLEMAVVAANNDAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSHOULDBEFINEAVVAAVVAAVVAISGOINGFORHEALTHCHECKUPTOMORROWAVVAAVVAAVVATHANKAVVAAVVAFORAVVAANSWERINGSOURPRAYERSAVVAAVVAILOVEHOLYMOTHERAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERMARYAVEMARIAAVVAAVVAPLEASEBLESSOURHOLYMOTHERHEALTHAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVAANDHEALTHREPORTSHOULDBEFINEWITHOUTANYPROBLEMAVVAAVVATHANKAVVAAVVAFORANSWERINGSOURPRAYERSAVVAAVVA……AVVAAVVAMANASAGOTSKINALLERGYAVVAPLEASECUREAVVAAVVATHANKAVVAFORANSWERINGSAVVAPRAYERSAVVA……AVVAILOVEAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAHOLYMOTHERAVVAAVVAPLEASEBLESSOURAVVAALLHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAHOLYAROGIAMAATHETHAAYIAVVAAVVATHANKAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVA……AVVAAVVAOURHOLYMOTHERAVVATHANKAVVAFORANSWERINGSOURAVVAPRAYERSAVVA……AVVAAVVAHOLYAVVAAVVAPLEASECONTINUETOBLESSALLOURAVVAHOLYMOTHERAROGIAMAATHATHAAYIAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEOURAVVAHOLYMOTHERAVVAAVVAAVEMARIAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVATHANKAVVAAVVAFORAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVA……AVVAAVVAILOVEAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAHOLYMOTHERAVVAAVVATHANKAVVAAVVAAVVAFORANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAPLEASECONTINUETOBLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAPLEASEAVVAALLREQUESTSCOMPLETEEARLYWITHOUTISSUESEVERYDAYAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAVEMARIAAVVAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVAPLEASECUREAVVAHOLYMOTHERAVVAHEALTHAVVAAVAAVVAHOLYMOTHERMARYAVVAAVVAISGOINGTOBLOODCHECKUPAVVATODAYAVVAAVVAAVVAAVVAHOLYAVVAAVVAAVVABLOODREPORTSHOULDBEFINEWITHOUTANYISSUESAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAJESUSAPPAAVVAAVVAGANESHAAPPAAVVAAVVAALLAHAPPAAVVAAVVAHOLYMOTHERMARYAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAILOVEAVVAAVVAWITHPUREHEARTAVVAAVVA……AVVAAVVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISFEELINGAVVAVERYTIREDAVVAAVVAPLEASEAVVACUREAVVAANDAVVABLESSAVVAWITHAVVAGOODSTRENGHTAVVAAVVAAVVATHANKAVVAAVVAFORANSWERINGOURAVVAPRAYERSAVVAAVA…..AVVAAVVAAVVAMANASAANDHOLYMOTHERAVVAAVVASHOULDBEWITHGOODUNDERSTANDINGSAVVAAVVAANDWITHOUTANYPROBLEMSAVVAAVVAAVVAMANASAISCONCEIVEDAVVAAVVAMANASASHOULDBLESSWITHAVVAAVVAHOLYBABYAVVAAVVABABYBOYAVVAAVVAAVVA……AVVAAVVARAJUANDRAGINIMARRIAGEGOTFIXEDANDAVVAAVVAAVVAOURFAMILIESAVVASHOULDNOTGETANYHEALTHPROBLEMSANDISSUESAVVAAVVATHANKAVVAAVVAHOLYMOTHERMARIAAROGIAMAATHETHAAYIAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERMARYMARIAAVVATHANKAVVAFORANSWERINGOURPRAYERSAVVAAVVAAVVAHOLYAVVAAVVACONTINUETOBLESSAVVAALLAVVAOURAVVAFAMILIESAVVAAVVAANDAVVAAVVAALLAVVAOURHOLYAVVAAVVAHEALTHAVVAAVVA……AVVAILOVEHOLYMOTHERMARIAAROGIAMAATHETHAAYIHOLYAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAAVVACONTINUETOBLESSAVVAOURAVVAALLAVVAHOLYMOTHERHEALTHAVVAANDAVVAAVVAHAPPINESSAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAVEMARIAAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVABLESSOURAVVAAVVAALLAVVAHEALTHAVVA……AVVAILOVEAVVAAVVATHANKAVVA……AVVAPLEASEBLESSMEWITHPEACEOFMINDAVVAAVVAILOVEHOLYMOTHERAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAPLEASECONTINUETOBLESSALLAVVAOURFAMILIESAVVAHEALTHAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVACUREAVVAAVVAMANASAHEALTHAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVVAAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAVVAAVVAPLEASEFORGIVEOURSINSFORWHATHAPPENYESTERDAYINRAGINIHOUSEAVVAAVVA……AVVAAVVAPLEASECONTINUETOBLESSAVVAALLAVVAOURAVVAFAMLIESAVVAAVVARAJUSHOULDMARRYGOODGIRLRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAVEMARIAAROGIAMAATHETHAAYIMARIAAVVAAVVA……AVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVA……AVVAAVVAPLEASEBLESSAVVAAVVAALLOURAVVAHEALTHAVVAAVVAAVVARAJUSHOULDMARRYRAGINIAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAVVAAVEMARIAAROGIAMAATHETHAAYIAVVAAVVAAVVA……AVVAAVVAPLEASEFORGIVEOURSINSAVVAVVA……AVVAAVVAPLEASEAVVAAVVABLESSAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVA……AVVAAVVAPLEASEAVVARAJUSHOULDMARRYRAGINIONLYAVVAAVVAAVVAVVAMANASAANDAVVABABYAVVAAVVASHOULDHAVEGOODHEALTHAVVAAVVANDAAVVAGOINGTOHEALTHCHECKUPAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSAVVAAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAISHOULDGETAVVAGOODMERITREVIEWAVVAAVVA……AVVAAVVATHANKAVVAAVVARAJUANDRAGINIMARRIAGEISFIXEDAVVAAVVAAVVANDAVVASHOULDNOTAFFECTOURFAMILIESAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA….AVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEOURSINSAVVAAVVA……AVVAAVVAHOLYAVVAAVVAPLEASEBLESSALLOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAPLEASEBLESSALLOURFAMILIESAVVAAVVARAJUGETMARRYWITHRAGINIAVVAVVAAVVAAVVATHANKAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVABLESSAVVAOURAVVAALLAVVAOURHOLYMOTHERHEALTHAVVAAVVAVVAAVVAAVVATHANKAVVAAVVAHOLYAVVAMOTHERAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOMIRACLEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSANDCUREAVVAAVVAAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVATHANKAVVAHOLYMOTHERAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEBLESSAVVAALLOURAVVAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAISGOINGTOAVVAHEALTHCHECKUPAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAHEALTHISSUESAVVAAVVAAVVATHANKAVVAAVVAFORBLESSINGSAVVAAVVAALLOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVA……AVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAPLEASEAVVAAVVACONTINUETOBLESSAVVAALLAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAPLEASEAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAHAPPYHOLYMOTHER’SDAYAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEDOAVVAMIRACLEAVVAAVVAAVVARAJUSHOULDMARRYGOODGIRLAVVAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVABLESSAVVAOURHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVAISHOULDGETGOODNAMEANDRECOGNITIONANDLEARNTECHNICALCOURSESINAVVAINFORMATIONSECURITYAVVAAVVAAVVAAVVAPLEASEDOSOMEAVVAMIRACLEAVVAAVVAINOURAVVVAALLAVVAFAMILIESAVVAAVVAAVVA……AVVAAVVATHANKAVVAAVVAFORANSWERINGSOURAVVAPRAYERSAVVAAVVAAVVAMANASAAVVAAVVASHOULDGIVEBIRTHANDAVVABLESSAVVATOAVVABABYBOYAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVA……AVVAAVVAMANASAANDATHOMEANDWITHMEAVVASOMEMISUNDERSTANDINGSAVVAAVVAPLEASEAVVASOLVEAVVAAVVAAVVAAVVAINMYHANDANDINBACKIGOTSOMELIKEGADDEAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVA……AVVAILOVEAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVA……AVVAILOVEAVVAAVVAAVVAAVVAHAPPYBIRTHDAYAVVATOAVVAST.ANTHONY’SAPPAAVVAAVVAAVVAILOVEAVVAAVVA……AVVAAVVAPLEASEHELPMETOGOTOALLCHURCHTEMPLEANDMOSQUEAVVAAVVAAVVA……AVVATHANKSGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLOURAVVAHOLYMOTHERHEALTHANDAVVAMANASAAVVABABYAVVAHEALTHANDAVVAAVVAPLEASEBLESSAVVAMANASAANDMEAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAILOVEHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVATHANKSGIVINGSAVVAAVVAAVVA……AVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAAVVAMANASAAVVABABYBOYSHOULDBEHEALTHYAVVAAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAAVVATHISSUNDAYAVVAGIRLSIDECOMINGTOHOMEPLEASEDOSOMEMIRACLEAVVAAVVAAVVAAVVADOCTORCUTTEDINMYBACK2GADDEAVVAAVVAAVVAPLEASECUREAVVAAVVAAVVATHANKAVVAAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERPRAYERSAVVAAVVAAVVAAVVAPLEASEFORGIVEOURSINSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEFORGIVEMYSINSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEBLESSAVVAOURAVVAALLAVVAAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVAAVVAANDAVVAMANASAAVVAHEALTHAVVAANDAVVAMANASAAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAOURAVVAMANASAAVVABABYAVVABOYAVVAGETTINGAVVAALLAVVABODYAVVAFEATURESAVVAAVVAPLEASEAVVABLESSAVVAWITHGOODHEALTHAVVAAVVAAVVATHANKAVVAFORAVAVVAANSWERINGSAVVAOURAVVAHOLYMOTHERMARYAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAPLEASEAVVABLESSAVVAALLAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVANDAAVVAAVVAMANASAAVVAANDAVVAOURAVVABABYBOYHEALTHAVVAAVVAAVVARAJUSHOULDGETMARRYWITHGOODGIRLAVVAAVVAANDAVVAEVENMYFRIENDSAVVAAVVAAVVAAVVAVVAAVVAPLEASEBLESSDILIPHEALTHAVVAAVVAAVVAHEISINHOSPITALAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVATHANKSAVVAAVVAFORANSWERINGSAVVAALLAVVAOURAVVAPRAYERSAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORAVVAALLAVVAANSWERINGSAVVAPRAYERSAVVAAVVAAVVAAVVACONTINUETOBLESSAVVAAVVAALLAVVAHOLYMOTHERMARYHEALTHAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVA……AVVAAVVAAVVAHAPPYAVVAMOSTSACREDHEARTOFJESUSAPPAAVVAFEASTAVVAAVVAAVVAILOVEHOLYMOTHERMARYAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA…….AVVAAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYHEALTHAVVAANDOURAVVABABYAVVABOYAVVAHEALTHAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAGIVINGSAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAFAMILIESAVVATOGOAVVALORDKUKKEAVVASUBRAMANYAAVVATEMPLEAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAWITHAVVAOURHOLYMOTHERMARYAVVABLESSINGSAVVAAVVAAVVAWEAREGOINGTOAVVAHOLYLORDKUKKESUBRAMANYATEMPLEAVVAAVVAAVVAMANASAISNOTCOMINGBECAUSEMANASAIS5THOR6THMONTHPREGNANTAVVAAVVAAVVAAVVAPLEASEAVVAFORGIVEUSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAHELPUSAVVAAVVAALLAVVAOURAVVAFAMILIESTOGOTOAVVAHOLYLORDAVVAMANTHRALAYAAVVATEMPLEAVVAAVVAAVVAAVVAAVVAAVVATHANKAVVAAVVAAVVAAVVAPOOJAAVVASHOULDHAPPENWELLAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAVVAAVVAGODAVVAAVVADARSHANAAVVANDAVVAPOOJAAVVAWENTWELLAVVAAVVAPLEASEBLESSAVVAALLAVVAAVVAOURAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVADOMNICHEALTHAVVAAVVAAVVAMANJUANDRAJUANDALLMYFRIENDSAVVASHOULDMARRYGOODGIRLAVVAAVVAAVVA…….AVVAAVVAAVVAPLEASEAVVAAVVAIAVVAAVVABEGAVVAAVVAOURAVVAAVVAMANASASHOULDAVVAAVVABLESSAVVAAVVAAVVAWITHAVVABABYAVVAAVVABOYAVVAAVVAAVVAAVVAPLEASEAVVATAKEAVVAALLAVVAOURAVVAFAMILIESAVVATOAVVALLAVVALORDHOLYPLACESAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVA……AVVAAVVAAVVAAVVATHANKSAAVVAAVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAROGIAAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVATODAYAVVAAVVAAVVAMYAVVAAVVAMERITAVVAAVVAREVIEWAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMEAVVAAVVAAVVA……AVVAAVVAAVVAPLEASERESOLVEALLAVVAOURAVVAFINANCIALSAVVAPROBLEMSAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVAAVVAFORBLESSINGSAAVVAAVVAIAVVAGOTAVVAAVVA12%HIKEAVVAAVVAAVVAAVVAAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAAVVAISHOULDLEARNTECHNICALSKILLSAVVAAVVAAVVA……AVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAROGIAAVVADEVIAVVAHEALTHAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAROGIADEVIMAATHETHAAYIAVVAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAOURAVVAAVVALOOKAVVAAVVAVERYTIREDAVVAAVVAANDAVVAGOTAVVAAVVACOLDAVVAAVVAANDAVVAFEVERAVVAAVVAPLEASEAVVAAVVACUREAVVAOURAVVAAVVAANDAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERMARYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAALLAVVAOURAVVAAVVAHOLYMOTHERMARYAVVAHEALTHAVVAAVVAAVVASHOULDBEAVVAALWAYSAVVAHAPPYAVVAAVVANDAVVAAVVAHEALTHYAVVAAVVAAVVA……AVVAAVVAAVVATHANKSAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAMARYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERMARYAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAAVVAAVVAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAGOTAVVAAVVACOLDAVVAAVVANDAVVAAVVACOUGHAVVAAVVAAVVAPLEASEAVVAAVVADOAVVAAVVAMIRACLEAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAAVVAAVVAAVVA…….AVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAANSWERINGSAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAHOLYMOTHERAVVAAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAANDAVVAAVVACUREAVVAALLAVVAHEALTHISSUESAVVAANDAVVAALSOAVVACUREAVVAAVVATENSIONSAVVAAVVAAVVAITRUSTAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVATHANKSAVVAAVVAFORAVVAANSWERINGSAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEHOLYMOTHERAVVAAAVVAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVASHOULDNOTHAVEAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAPLEASEAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVACOLDANDCOUGHAVVAAVVAANDAVVAAVVAALSOAVVAAVVASHOULDNOTHAVEANYHEALTHPROBLEMSAVVAAVVAAVVAANDAVVAAVVASHOULDNOTHAVEANYTENSIONSAVVAAVVAVVAAVVAAVVA……AVVAAVVAAVVAAVVAMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEOURHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAANDAVVAAVVACUREHOLYMOTHERHEALTHAVVAAVVATHISWEEKAVVAAVVAOURAVVAAVVAGOINGTOAVVAAVVAHEALTHCHECKUPTOHOSPITALAVVAAVVABUTAVVAAVVAWEDONTKNOWWHICHHOSPITALAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVANDAVVAAVVAAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAAVVAHAVEMISUNDERSTOODMEAVVAAVVAAVVAAVVAPLEASEAVVAAVVARESOLVEAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEOURHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURBROTHERAVVAAVVAANDOURFAMILIESWENTOAVVALORDAVVAAVVAKALASTHITEMPLEAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAUSAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAOURAVVAHOLYMOTHERAVVAAVVAANDAVVAMEORMYBROTHERAVVAAVVAGOINGTOHOSPITALFORAVVAOURAVVAHOLYMOTHERAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAALWAYSAVVAAVVAAVVAANDAVVAAVVAHEALTHAVVAAVVAREPORTSHOULDBEFINEAVVAAVVAWITHOUTAVVAANYPROBLEMSAVVAAVVAAVVAAVVAANDAVVAAVVACUREAVVAAVVAOURAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAAVVALORDAVVAAVVAKALASTHIAVVAAVVATEMPLEAVVAAVVANAGADOSHAPOOJEAVVAAVVAHAPPENEDVERYWELLAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEAVVAAVVAFINEAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAALWAYSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVASAFEGUARDAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVAANDAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAISGOINGTOHEALTHCHECKUPAVVAAVVATHISWEEKAVVAAVVAPLEASEAVVAAVVABEWITHAVVAOURAVVAAVVAANDWITHUSAVVAAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAHEALTHREPORTAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAITRUSTAVVAAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAVVAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVASAFEGUARDAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVABLESSAVVAAVVAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAHAPPYAVVAAVVAVARAMAHALAKSHMIDEVIAVVAAVVAHABBAAVVAAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVAHAVEAVVAAVVAEVERYDAYMORNINGAVVACOFFEEBREAKFASTAVVAAVVAEVERYDAYAFTERNOONAVVALUNCHAVVAAVVAEVERYDAYEVENINGAVVACOFFEEAVVAAVVAEVERYDAYNIGHTAVVADINNERAVVAAVVAEVERYDAYAVVAAVVAONTIMEAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVABABYAVVAAVVATHIMMANNAAVVAAVVANDAVVAAVVABABYAVVAAVVAFAMILIESAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAAVVACUREAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYBABYAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAITRUSTAVVAAVVAILOVEHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSAVVAAVVAFORAVVAAVVAAVVAAROGIAAVVAAVVAMAGUAVVAAVVAAROGIAAVVAAVVAAVVAAVVANAGUAVVAAVVAAVVAMAGUAVVAAVVANAGUAVVAAVVAKAPADITHGEAVVAAVVATHUMBAAVVAAVVATHANKSAVVAAVVA……AVVAAVVAILOVEOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVATHANKSGIVINGAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYAVVAAVVABABYHEALTHAVVAAVVAHEALTHAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAFORAVVAAVVABLESSINGSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAOURAVVAAVVAAVVAAROGIAAVVAAVVAAVVAMAGUVUAROGIAAVVAAVVAAVVANAGUVUAVVAAVVAAVVAMAGUNAGUVUAVVAAVVKAAPADITHGEAVVAAVVAAVVAAVVATHUMBAAVVAAVVATHANKSGIVINGAVVAAVVAILOVEAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAHELPMEAVVAAVVANOTTOGETANYERRORAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHAPPYHOLYMOTHERFEASTAVVAAVVASTARTINGFROM29THAUGUSTAVVAAVVANDAVVAAVVAHAPPYGANESHAFESTIVALAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAOURAVVAAVVABABYAVVAAVVABOYAVVAAVVAHEALTHAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAHAPPYHOLYMOTHERFEASTAVVAAVVAHAPPYHOLYGANESHAHABBAFESTIVALAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAHAPPYOURAVVAAVVAHOLYMOTHERAVVAAVVABIRTHDAYAVVAAVVAANDAVVAAVVAHAPPYAVVAAVVAHOLYMOTHERAVVAAVVAFEASTAVVAAVVAPLEASEHELPMETOGOTOAVVAAVVAHOLYMOTHERCHURCHBY3.30PMTODAYAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAIAVVAMISSAVVAOURAVVAAVVAAVVATODAYAVVAISGOINGTOSTOMACHSCANNINGAVVAAVVAAVVAANDAVVAAGAINAVVAAVVAANDWEAVVAAVVAGOINGONSATURDAYAVVAAVVAFORHEALTHREPORTRESULTSAVVAAVVAAVVAPLEASEAVVABEWITHAVVAAVVAAVVAANDWITHUSAVVAAVVAANDAVVAAVVADOMIRACLESAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAOURAVVAHOLYMOTHERAVVAAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEBLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVATOMORROWAVVAAVVAOURAVVAAVVAANDAVVAAVVAMEGOINGTOAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAPLEASEBEWITHUSAVVAAVVAAVVAHEALTHREPORTSHOULDBEFINEWITHOUTANYHEALTHISSUESAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAILOVEHOLYMOTHERAVVAAVVAROGIAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAGAINAVVAAVVAOURAVVAAVVAANDMEAVVAAVVAGOINGTOHOSPITALONTHISSATURDAYAVVAAVVAAVVAOURAVVAAVVAFORHEALTHCHECKUPAVVAAVVAPLEASEAVVAAVVABEWITHAVVAOURAVVAAVVAAVVAANDAVVAAVVAWITHUSAVVAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAAVVAHEALTHREPORTAVVAAVVAANDAAVVAAVVAOURAVVAAVVAHEALTHSHOULDBEFINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAANDAVVAHELPAVVAAVVAAVVAINHOSPITALAVVAAVVAANDAVVAAVVABEWITHAVVAAVVAAANDAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVATHYROIDAVVAAVVAPROBLEMAVVAAVVAAVVANDAVVAAVVAINEVERYTHINGAVVAAVVAALWAYSAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMAATHETHAAYAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHANKSGIVINGAVVAAVVAFORAVVAAVVAANSWERINGOURPRAYERSAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVASRIANJANEYASWAMYAVVAAVVACARFESTVIALAVVAAVVAAVVAAVVAHAPPYAVVAAVVAHOLYAVVAAVVAVIJAYADASHAMIFESTIVALAVVAAVVAAVVAANDAVVAAVVABLESSAVVAAVVAOURAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAWITHAVVAAVVALOTSOFAVVAAVVAHAPPINESSAVVAAVVAAVVAPLEASEAVVAAVVAHAVEEVERYDAYMORNINGAVVAAVVAHAVEAVVAAVVABREAKFASTANDCOFFEEAVVAAVVAAVVAEVERYDAYAVVAAVVAAFTERNOONAVVAAVVAHAVEAVVAAVVALUNCHAVVAAVVAAVVAEVERYDAYEVENINGAVVAAVVAHAVEAVVAAVVACOFFEEORTEAAVVAAVVAAVVAAVVAAVVAEVERYDAYNIGHTAVVAAVVAHAVEAVVAAVVADINNERAVVAAVVAAVVAONTIMEAVVAAVVAAVVAEVERYDAYAVVAAVVAAVVAWITHOUTMISSINGANYDAYAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVAAVVAAVVATOMORROWAVVAAVVAANDAVVAOURAVVAAVVAANDMEAVVAAVVAGOINGTOHOSPITALAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAOURAVVAAVVAANDAVVAWITHUSAVVAAVVAAVVAANDAVVAAVVAGUDEAVVAOURAVVAAVVAAVVAFORAVVAAVVAOURAVVAAVVAHEALTHREPORTCHECKUPAVVAAVVAAVVAOURAVVAAVVAHEALTHSHOULDBEFINEANDGOODAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPTODAYAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAOURAVVAAVVAAVVANDAVVAAVVAGUIDEUSAVVAAVVAAVVAAVVANDAVVAAVVAWITHMYBROTHERAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAPLEASEBLESSAVVAAVVAOURATHEAVVAMUDAMMASOULAVVAAVVAANDAVVAAVVABLESSAVVAAVVATHEIRFAMILIESAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMMAMAATHETHAAYIAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVAAHOLYMOTHERAVVAAVVATHANKSAVVAAVVAFORANSWERINGAVVAAVVAOURAVVAAVVAPRAYERSAVVAAVVAAVVAOURAVVAAVVAHEALTHAVVAAVVAISFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAOURAVVAAVVAHEALTHREPORTISALSOFINEAVVAAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAOURAVVAAVVANEIGHBOURAVVAAVVAGRANDMOTHEREXPIREDAVVAAVVAAVVAPLEASEAVVAGIVEAVVAAVVAPEACETOAVVAVVAGRANDMOTHERAVVASOULAVVAAVVAAVVAANDAVVAAVVAHELPAVVAAVVATHEIRFAMILIESAVVAAVVAAVVAFROMAVVAAVVAOCTOBER14THTUESDAYAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVAPOOJEISSTARTINGAVVAAVVAAVVAANDON18THOCTOBERSATURDAYCARFESTIVALAVVAAVVAAVVAOURAVVAAVVAOURAVVAHOLYLORDAVVAAVVASRIANJANEYASWAMYAVVAAVVACARFESTIVALSHOULDCOMEWELLAVVAAVVAANDAVVAAVVAGUIDEUSWITHOUTPROBLEMSAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVASHOULDNOTRAINNEXTWEEKAVVAAVVAAVVAAVVAANDAVVADOMNICANDTHIERFAMILIESCOMINGTOAVVAAVVAOURAVVAHOLYAVVAAVVAVELANKANNIAVVAAVVACHURCHAVVAAVVAPLEASEGUIDETHEMAVVAAVVAAVVAAVVAAVVAPLEASEHELPMYOFFICEPROJECTAVVAAVVAAVVANDAVVAAVVAAVVABEWTHUSINEVERTHINGAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAANDAVVAAVVAMEAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAMMAMAATHETHAAYIAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVATODAYFIRSTDAYAVVAAVVAANDAVVAAVVATILLAVVASATURDAYAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAPOOJEAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAANDAVVAAVVATHISAVVAAVVASATURDAYAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVACARCHARIOTAVVAAVVACARFESTIVALAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAITSHOULDNOTAVVAAVVARAINAVVAAVVATHISWEEKAVVAAVVAANDAVVAAVVANEXTWEEKAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAFORAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVACAMEOUTVERYWELLAVVAAVVAAVVAANDAVVAAVVABLESSINGAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAANDAVVAAVVAALSOAVVAAVVAOURSINSAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYSTATUEAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYSTATUESHOULDBEFINEAVVAAVVAANDAVVAAVVASHOULDBEBEAUTIFULAVVAAVVAAVVAAVVAPLEASEAVVASHOULDNOTHAPPENANYDAMAGEAVVAAVVAPLEASEAVVAAVVALOOKAFTERAVVAAVVAANDAVVAAVVADOSOMEMIRACLESAVVAAVVAAVVAAVVADAILYPOOJEAVVAAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYLORDSRIANJANEYASWAMYPALLAKIAVVAAVVASHOULDBEFINEAVVAAVVANDAVVAAVVASHOULDBEAVVAAVVABEAUTIFULAVVAAVVAANDAVVAAVVAHOLYLORDARIANJANEYASWAMYAVVAAVVAAVVASHOULDBEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………..AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAOURAVVAAVVAAVVAPALLAKKIAVVAAVVAAVVATOMORROWAVVAAVVAANDAVVAAVVAOURAVVAAVVAAVVASHOULDNOTHAVEANYPROBLEMSAVVAAVVAANDAVVAAVVAGUIDEUSAVVAAVVAAVVAAVVAMANASAMADEAVVAAVVAMADEVOMITAVVAAVVAANDITWASINLITTLEREDAVVAAVVAPLEASEAVVAAVVABLESSOURAVVAHOLYBABYAVVAAVVAAVVAANDAVVAAVVAMANASAAVVAAVVAAVVAISHOULDNOTGETANYERRORINPROCESSAVVAAVVAAVVAPLEASEAVVAAVVABLESSMEAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAOURAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAVVAAVVAHAPPYAVVAAVVADEEPAVALIAVVAAVVAAVVAAVVATHANKSAVVAAVVAAVVAFORANSWERINGAVVAAVVAPRAYERSAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSWAMYANJANEYAAVVAAVVAGODAVVAAVVACHARIOTAVVAAVVAAVVAWASBEAUTIFULAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYLORDSWAMYANJANEYAAVVAAVVAAVVABALAAVVAAVVAHAVINGAVVAAVVASOMECRACKAVVAAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAPERMANENTLYAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAMANASAAVVAAVVASHOULDHAVVAAVVANORMALDELIVERYAVVAAVVAAVVAWITHAVVAAVVAAVVABLESSINGSOFAVVAAVVABABYBOYAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYAVVAAVVABALIPANDAMIAVVAAVVAAVVAAVVATHISSUNDAYAVVAAVVAMANASAAVVAAVVAISGOINGTOHERHOUSEAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMANASAAVVAAVVAWITHAVVAAVVABABYAVVAAVVABOYAVVAAVVAAVVAWITHAVVAAVVAAVVANORMALAVVAAVVADELIVERYAVVAAVVAAVVATHISSUNDAYAVVAAVVAAVVASENDINGAVVAAVVAMANASAAVVAAVVAFUNCTIONSHOULDHAPPENBEAUTIFULAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAVEMARIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAISHOULDNOTGETANYERRORINPROCESSAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAMEAVVAAVVATODOAVVAAVVAAVVASOMEMIRACLEPROJECTAVVAAVVAANDAVVAAVVADEVELOPANDLEARNAVVAAVVAINTECHNICALTRAININGSAVVAAVVAAVVADOAVVAAVVASOMEMIRACLEAVVAAVVAAVVAMIRACLEAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVAMANASAAVVAAVVAANDAVVAAVVAAVVAOURAVVAAVVAAVVABABYAVVAAVVABOYAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVVAAPPAAVVAAVVAAVEAVVAAVVAMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVASISTERROHINIMARRIAGETOMORROWAVVAAVVANDAVVAWEDNESDAYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVABLESSAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYLORDAVVAAVVASRIANJANEYASWAMYGODAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAAVVAAVVABLESSAVVAAVVAANDAVVAAVVAAVVAAVVACUREAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYLORDSRIANJANEYASWAMYAVVAAVVAAVVAAVVASTATUEAVVAAVVAAVVAAVVAPLEASEAVVAAVVAHELPMETOGOTOAVVAAVVAHOLYPLACEAVVAAVVAMANTHRALAYAAVVAAVVATOMORROWAVVAAVVAMORNINGAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAMANASAAVVAAVVAAVVAAVVATOGIVEBIRTHTOAVVAAVVAHOLYBABYAVVAAVVABOYAVVAAVVAAVVAAVVAWITHNORMALDELIVERYAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVASISTERROHINIANDAVVAAVVAHERHUSBANDAVVAAVVAVINODHKUMARAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVABROTHERAVVAAVVATOGETGOODGIRLAVVAAVVAFORHISMARRIAGEAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAROGIAAMMAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……....AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVATOGIVEAVVAAVVABIRTHAVVAAVVATOHOLYBABYAVVAAVVABOYAVVAAVVAWITHAVVAAVVANORMALDELIVERYAVVAAVVAAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMAHESHAVVAAVVAHOLYBABYAVVAAVVAGIRLAVVAAVVAAVVAAVVAAVVAMANYMANYMANYMANYMANYMANYMANYMANYMANYTHANKSGIVINGSAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYAVVAAVVAHOLYLORDHANUMANSRIANJANEYASWAMYAVVAAVVAAVVAJAYANTHIAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAHOLYMOTHERAVVAAVVHEALTHAVVAAVVAALWAYSAVVAAVVAAVVAAVVAAVVAWITHAVVAAVVAOURAVVAAVVAGRACEAVVAAVVAANDAVVAAVVABLESSINGSAVVAAVVAMEAVVAAVVAANDAVVAAVVAMYWIFEMANASAAVVAAVVABLESSEDAVVAAVVAWITHAVVAHOLYBABYGIRLAVVAAVVAONAVVAAVVAAVVASATURDAYAVVAAVVAAVVANOVEMBER15THAT1.12PMAVVAAVVAAVVAAVVAANDAVVAAVVAAVVAHOLYBABYNAMEISAVVAAVVAMANASVINIAVVAAVVAANDAVVAAVVAMARIAMARYAVVAAVVAAVVAANDAVVAAVVAAVVAINFUTUREAVVAAVVAAVVAWITHAVVAAVVAHOLYMOTHERAVVAAVVABLESSINGSAVVAAVVAANDAVVAAVVAAVVAHOLYMOTHERAVVAAVVAGRACEAVVAAVVAAVVAMYAVVAAVVAANDAVVAAVVAMYWIFEAVVAAVVAAVVASECONDHOLYBABYNAMEISAVVAAVVAAVVAHOLYLORDMASHAALLAHHOLYLORDSUBRAMANYASWAMYAVVAAVVAHOLYLORDINFANTJESUSAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAPLEASEBLESSAVVAAVVAMEAVVAAVVAANDAVVAMYWIFEMANASAAVVAAVVAWITHAVVAAVVASECONDCHILDAVVAAVVAWITHAVVAAVVABABYBOYAVVAAVVAAVVAYESTERDAYBONUSREVIEWGOTOVERAVVAAVVAIGOT460000ANDAVVAAVVASPRATINGAVVAAVVANEXTMONTHAVVAAVVAMYDESIGNATIONAVVAAVVAANDAVVAAVVASALARYCORRECTIONAVVAAVVASHOULDHAPPENAVVAAVVAAVVAPLEASEAVVAAVVAHELPAVVAAVVAMEAVVAAVVATOLEARNAVVAAVVATECHNICALKNOWLEDGELIKESCRIPTINGAVVAAVVAANDAVVAISHOULDNOTGETANYPROCESSERRORAVVAAVVAANDAVVAAVVAISHOULDNOTGETANYERRORAVVAAVVAGOINGFORWARDAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAVVAHOLYMOTHERAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPONCOMINGMONDAYAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAANDAVVAGUIDEUSAVVAAVVAAVVAHEALTHREPORTSHOULDBEFINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVACHESTPAINAVVAAVVALEGPAINAVVAAVVATIREDNESSAVVAAVVATHROATPAINAVVAAVVAANDAVVAAVVACOUGHAVVAAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAANDAVVAAVVAOURSINSAVVAAVVAWHATALLWEDIDAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHAPPYMERRYCHRISTMASAVVAAVVAAVVAHAPPYNEWYEARAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAANDAVVAAVVAMEAVVAAVVAISGOINGTOHOSPITALHOMEOHEALTHCAREINTERNATIONALAVVAAVVATOMORROWAVVAAVVAWEDNESDAYAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABEWITHUSAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHREPORTAVVAAVVAAVVASHOULDBEFINEAVVAAVVAAVVAWITHOUTAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAAVVADOAVVAAVVASOMEMIRACLEAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEAVVAAVVAHOLYTHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVA......AVVAAVVAAVVAAVVAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVABEWITHAVVAOURAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAOURAVVAAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAAVVATHROATPAINAVVAAVVAAVVAOURAVVAAVVAHOLYMIRACLEAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVAFORGIVEAVVAAVVAMYSINSAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEHOLYTHAAYIHOLYAVEMARIAHOLYTHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA…......AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAALLAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHROATPAINAVVAAVVAAVVAALLAVVAAVVAAVVAOURAVVAVVAAVVAHOLYMORTHERAVVAAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……… AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAThe Prayer to the Sacred HeartAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA Oh Lord Jesus Christ, to Your most Sacred Heart I confide this intention { AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHAPPYNEWYEARAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAMANJUAVVAAVVAFAMILYAVVAAVVAANDAVVAAVVAHISAVVAAVVAFATHERSOULAVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAALLHEALTHTESTBLOODTESTTHROATTESTAVVAAVVAANDAVVAAVVAOURAVVAAVVAHOLYAVVAAVVAALLHEALTHREPORTSAVVAAVVASHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……….AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAOURAVVAAVVADOAVVAAVVAMIRACLESAVVAAVVAINAVVAAVVAOURAVVAAVVAFAMILIESAVVAAVVAAVVAPLEASEICANTAVVAAVVASEESTRUGGLINGHEALTHPROBLEMSAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAOURAVVAAVVAHELPAVVAAVVAOURAVVAAVVAHOLYMOTHERTOGOTOHOSPITALFORHEALTHCHECKUPAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAAVVACUREAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAHOLYMOTHERHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAOURAVVAAVVAANDAVVAAVVAMEAVVAAVVAOURAVVAAVVABROTHERAVVAAVVAGOTOHOSPITALAVVAAVVAFORAVVAAVVAOURAVVAAVVAHEALTHCHECKUPAVVAAVVAAVVAPLEASEAVVAAVVAGUIDEAVVAAVVAOURAVVAAVVAANDAVVAAVVAUSAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHEALTHREPORTSSAVVAAVVAHOULDBEFINEAVVAAVVAWITHOUTANYPROBLEMSAVVAAVVAAVVAAVVAPLEASEAVVAAVVAOURAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAEVILSPRIRTAVVAAVVAANDAVVAAVVAALSOAVVAAVVAINMYHOMEAVVAAVVAAVVAAVVATHANKSGIVINGSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHEAVVAAVVATHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………}. Only look upon me, then do what Your love inspires. Let Your Sacred Heart decide. I count on You. I trust in You. I throw myself on Your mercy. Lord Jesus, You will not fail me. Sacred Heart of Jesus, I trust in You. Sacred Heart of Jesus, I believe in Your love for me. Sacred Heart of Jesus, Your kingdom come. Sacred Heart of Jesus, I have asked You for many favors, but I earnestly implore this one. Take it, place it in Your open Heart.When the Eternal Father looks upon it, He will see it covered with Your Precious Blood. It will be no longer my prayer, but Yours, Jesus. Sacred Heart of Jesus, I place all my trust in You. Let me not be disappointed. Amen.AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAPLEASEAVVAAVVAAVVAAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAVVAHEALTHREPORTSSHOULDBEFIINEWITHOUTANYHEALTHPROBLEMSAVVAAVVAAVVAAVVAPLEASEAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHEMOREYOUHONOURMETHEMOREIWILLBLESSYOUAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAALLAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……....AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAHEALTHAVVAAVVAAVVAISGOINGTOHOSPITALFORHEALTHCHECKUPAVVAAVVATODAYAVVAAVVAWITHAVVAAVVAMYBROTHERAVVAAVVAAVVAPLEASEAVVAAVVABEWITHAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAANDAVVAAVVAGUIDEAVVAAVVAUSAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAANDAVVAAVVAAVVAWITHOUTANYAVVAAVVAHEALTHISSUESAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAANDAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAIAVVAAVVAAVVATRUSTAVVAAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAOURAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA………AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAPLEASEAVVAAVVAIBEGAVVAAVVAPLEASEAVVAAVVAAVVABLESSAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERHEALTHAVVAAVVAAVVAAVVAANDAVVAAVVAMEAVVAAVVAISGOINGTOHOSPITALAVVAAVVAONMONDAYAVVAAVVAAVVAFORAVVAAVVAAVVAOURAVVAAVVAAVVAALLAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVACHECKUPAVVAAVVAAVVAPLEASEAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAVVAAVVAHEALTHREPORTSSHOULDBEFINEAVVAAVVAAVVAWITHOUTAVVAAVVAAVVAAVVAANYAVVAAVVAHEALTHPROBLEMSAVVAAVVAAVVAAVVADOCTORSHOULDPRESCRIBEAVVAAVVAPROTEINSAVVAAVVAAVVAANDAVVAAVVAAVVAVITAMINSAVVAAVVATABLETSAVVAAVVAAVVAAVVAFORGIVEMYSINSAVVAAVVAAVVAITRUSTAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAAROGIAAMMAMAATHEVELANKANNIAVVAAVVAMAATHETHAAYIAVVAAVVAAVEMARIAAVVAAVVATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……AVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAPLEASEAVVAAVVABLESSAVVAAVVAOURAVVAAVVAALLAAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAAVVAAVVAPLEASEAVVAAVVACUREAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVAHEALTHAVVAAVVAPROBLEMSAVVAAVVAAVVAPLEASEAVVAAVVAAVVACUREAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAVVATHROATAVVAAVVAAVVAPAINAVVAAVVAAVVAANDAVVAAVVAAVVAPROBLEMSAVVAAVVAAVVAAVVAAVVAOURAVVAAVVAAVVABROTHERAVVAAVVAAVVAMARRIAGEAVVAAVVAAVVAGOTFIXEDAVVAAVVAAVVAAVVAMARRIAGEAVVAAVVAAVVAISONAVVAAVVAAVVAJUNE11THAVVAAVVAAVVAANDAVVAAVVAAVVAJUNE12THAVVAAVVAAVVAAVVAPLEASEAAVVAAVVAAVVABEAVVAAVVAAVVAAVVAWITHAVVAAVVAAVVAUSAVVAAVVAAVVAAVVAPLEASEAVVAVVAAVVABLESSAVVAAVVAAVVAMEAVVAAVVAWITHAVVAAVVAAVVAHOLYAVVAAVVAAVVABABYBOYAVVAAVVAAVVAAVVATHANKSGIVINGAVVAAVVAAVVAAVVAAVVAAVVAFORAVVAAVVAAVVAGIVINGAVVAAVVAAVVABEAUTIFULCUTEAVVAAVVAAVVABABYGIRLAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAILOVEAVVAAVVAAVVAOURAVVAAVVAAVVAHOLYMOTHERAVVAAVVAAROGIAAMMAMAATHETHAAYIAVVAAVVAAVEAVVAAVVAMARIAAMMATHAAYIAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVAAVVA……… Bangalore 2015-05-07
rekha My friend maya suffering alot of pain bz they have no babys Holly mother kindly blessed her with baby to make her happy Insted of her i will come for every year prey for her , this my wish . If my desire become true i offed 5oo candles for u ......it will happend . Bz its my belive .... banglore 2015-05-07
rekha My friend maya suffering alot of pain bz they have no babys Holly mother kindly blessed her with baby to make her happy Insted of her i will come for every year prey for her , this my wish . If my desire become true i offed 5oo candles for u ......it will happend . Bz its my belive .... banglore 2015-05-07
m Dear amma.my father prasadarao has been suffering fro witchcrafts since 8 months done by a lambadi lady for 3 times..she is doing for every amavasya repeating every month.she want death of my father,she want to kill my father by any means.she is doing with a big group, all joined together and doing black magic to my dad.again amavasya coming amma..we are so scared for what will happen to Dad. He is suffering from severe gastric indigestion..his body is getting warmer not sleeping properly, trembling in night..amma touch my father ,give him deliverance from all evil bondages and witchcrafts power.amma give us transfer to a new place very far from this lambadi Lady's place.give us transfer to andhra region mostly Vijayawada and rajahmundry.. Protect my father's life and save him from life threat of witchcrafts...he is having gall stones and prostrate problem ,heal him amma. mahboobnagar 2015-05-07
m Dear amma.in my marriage settlement people are so worst and the boy also very worst not replying us.his father torturing us without giving reply and putting all words on us..pls change boy and fahthers attitude..pray that they should give us reply mahboobnagar 2015-05-07
maniyan paramasivam amma. i submitted my wants and requests to you so far amma. i am sorry for all my bad behaviors i did so far amma. i come to you amma. i am sorry . i will not do these bad things if i get all my requests amma. i will not do bad things amma. no wil need your blessings and your love and make me so so lucky and very very perfect and no.1 medical physicist, very fast problem solving skills and successful person amma. with your blessings maniyan paramasivam. i just believe in you amma. i f i really i get all of my requests i asked you amam. i will be good and i will do good things amma. i love you amma. i will do things to orphans house amma. i need you amma. i really want you to be good and do good things amma. with your blessings maniyan paramasivam. i love you amma. i am sorry noid 2015-05-07
Babymol I'm a new immigrant who reached in Canada with my two daughters as a result of cheating from my husband as he reached early.When he reached here itself he has become a gay who used to live with many and leads a life vulgar gay.When I came to know he told me to go back or suicide.I don't know what to do as I cannot go back as my girls studies and one of them is diabetic. Please pray for me I'm dying day by day. I have a part time job even I could not do that.Request a miracle to bring the man to the path of repentance as y kids need a father. Please pray for the helpless mother Brampton.ON, Canada 2015-05-07
Babymol I'm a new immigrant who reached in Canada with my two daughters as a result of cheating from my husband as he reached early.When he reached here itself he has become a gay who used to live with many and leads a life vulgar gay.When I came to know he told me to go back or suicide.I don't know what to do as I cannot go back as my girls studies and one of them is diabetic. Please pray for me I'm dying day by day. I have a part time job even I could not do that.Request a miracle to bring the man to the path of repentance as y kids need a father. Please pray for the helpless mother Brampton.ON, Canada 2015-05-07
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless my health amma.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-07
V.christina o Mother , my mother please pray for my family,my husband leave me 1 year ,amma pls change my husband rechard mariselvam come back wit me and with my daughter , dear amma please change him bad behavior to come good man.o mother of the world in your mercy hear my pray and answer.Amen malaysia 2015-05-07
ak Jesus pls show me d way pls naku job kavali mother pls pray to jesus job kuda undi kani atuvalty ma Atha tho obvius garelations breakup avtudi Vat i have to do now na situatuon niku talsu jesus naku economical ga naku job avsasrla kani nakuna dreams implement chayali anty tapadu pls jesus pls show me d way mother ,avay davuda am asking dis wishes in a name of u son my father jesus ....amen l 2015-05-07
vinu thomas amme mathave njangalku nee dinamprethi tharunna kripa kadakshathinai njangal nanniyode orkunnu. njangalku nee thanna jeevitha sawbagyangalkai ninnodu stothram cheyyunnu. njangal anubahvikkunna kashtapadukalilum durithangalilum sambathika njerukkangalilum joliyillatha avasthakalilum njangalude koode ninnu njangale kathu paripalikkunathinumayi njangal ninnodu sthuthi padunnu. njangalude avasthakalku mattamundakkitharuvanayittu ammayude puthran thamburonodu njangalku vendi mathyastham vahikkaname ennu apekshikkunnu. njangalku ninte kripayum, anugrahavum, kadakshavum varshikaname amme. KOCHI 2015-05-07
Sheeba Anbu mathave,Please help my parents and my sister for the land problem.She told me sometime yesterday it was solved.But didn't solve yesterday.Please Amma solve the problem and we want build the compound wall around my father's plot.Please help for that Amma.We are very sad .Destroy the opposite parties and president also.Please help them..... Kuwait 2015-05-07
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted> mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good increment, good promotion. Mother please bless us sort our family dispute. Mother please bless my family peace n happiness. Mother please free avi n me of all worries n tension./ Mother please bless my dad eternal peace. Mother please bless my mom good health. mumbai 2015-05-07
Arokiaraj Dear Mother Mary, I am really worried about my IELTS exam which is on 9 may 2015. I am fully blank, left with lots of future worries even you have blessed me with a supportive wife and family and 2 lovely kids still i have lost patience and faith on me. i have only you to bless me for a better life and for my family. You only can do remarkable wonders. Please forgive this sinner and give me a chance of winning in the life. Cuddalore 2015-05-06
jerom rozario Im jobless since 2 n a half year.im trying my best everywhere i have tried but no positive reply has come dear madha please show me a way help me n bless me n i also place my newly married life in ur feet bless us with a child.maa if it is ur will then atleast for once take us to ur holy shrine basilica of vailankanni. kolkata 2015-05-06
mary magdalene Dear MOTHER MARY,thank u for giving me gud parents,and guiding in the right path and protecting me till this moment....Oh gracious MOTHER MARY,shower ur blessings on me to get gud marks and to move to the next part of our life..Thank u MOTHER MARY, for being with me and protecting me all through the 14 years of my school life..I humbly request u mother to shower ur abandant blessings on me and and my friends to choose their next part of their life in the correct path,this i ask in the name OF OUR LORD JESUS CHRIST.AMEN neyveli 2015-05-06
ak Dear mother thank u and tank u jesus for change my dad thought and he agreed to go my sis mother pls praay to jesus to my wishes if i once remember my wishes i have only way to cry jesus u knoe very well pls gve me patience pls aavay dava am asking dis in d name of u r loving son jesus ..... Amen f 2015-05-06
BAVITHRA BASKER i request u to pray for me and my friends to get more marks in board exams and to get a good college.I also pray for my family. neyveli 2015-05-06
BAVITHRA BASKER i request u to pray for me and my friends to get more marks in board exams and to get a good college.I also pray for my family. neyveli 2015-05-06
Sheeba Amma I didn't get good news that is the land problem solved .I feel very sad.Amma please help my parents and my sister.please solve the problem very quickly with peace. Kuwait 2015-05-06
pcn Dear Mother Mary, I had submitted a prayer request - to own a house of our own so that we need not give rent, I thank matha as i have confidence this prayer will be answered,surely hosur 2015-05-06
vinu thomas amme mathave njangale dinamprethi anugrahikkunnathinai stothram cheyyunnu. njangalku annennu venda ella karyangalum nadathitharunnathinayitu angeyku stothram cheyyunnu. njangalkuvendi puthren thamburanodu madhyastham vahikaname ennu apekshikkunnu KOCHI 2015-05-06
Sheeba Amma,Please solve the land problem today quickly and help my parents and my sister. Please Amma, I also very sad because of this problem.Please Amma scatter the enemies.we want solve tis problem today and quickly with peace and blessings. todad I want good news from my sister ie solved this land problem with peace. Amma I am waiting.Please Amma............ Kuwait 2015-05-06
mary thresa dear mother mary,kindly shower ur blessings on me to get gud marks and gud clg...gracious mother,shower ur blessings on me and my famliy also to stay in gud health now and forever this i ask in the name of our LORD JESUS CHRIST..AMEN cuddalore 2015-05-06
V.christina O Mother , my mother pray for my family, my husband rechard mariselvam leave me go,pls he back wit me and with my daughter.dear amma pls change my husband bad Behavior to come good person,he must change all bad attitude , amma please change him,pls amma.o mother of the world in your mercy hear and answer my pray.Amen malaysia 2015-05-06
Sheeba Amma The opposite parties are not allowed to build the compound wall around the my father's property.Also they are not allowed the government officers (including thasildhar) to put the elgai kallu .They are always fighting.Amma now this problem is going to the court. Amma, when this problem will solve?How ? Who will help to solve this problem?How much amount will spoil to this problem ? How we can relief from this finance problem?.When we get the peaceful mind?Why they are not allowing to build the compound wall? Now they are happy because you keeping always happy them.So they are fighting with my father from the last 37 years.How my father can digest this fail.?Amma where are you and your son?We are waiting for you? because you can solve this problem.Nobody can't solve this problem but you can. PLease............. today also my father couldn't. The opposite parties are not allowing to take the wood also. Now I want solve this problem. How many times the surver messure the plot.But the opposite parties are telling this is wrong. wrong.... Please ammma we can't solve this problem.You come and solve this problem.We are verr very sad. Kuwait 2015-05-06
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-06
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless my parents journey.give them good health.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-05-06
sm Ende Mathave Please interecede forus.Mathave thou have always interceded for us .MAthave please bless us with healthy baby. Amma we will come to Manarcad church with baby. Please MATHAVE PLEASE intercede and pray for us. Thanks for all thay blessings US 2015-05-06
r dear mother I beg you help cl to get the money which is lost open some door mother help us mother from where can we get the money from no where jesus I beg you pls intercede with yr son to get some finance for us we have tried so much all is in vain m 2015-05-06
m Dear amma.my father has been suffering from witchcrafts since 8 months doe by a lady for 3 times in order to kill him.she wants death of my father.his health is disturbed suffering from 1 new problem on each day.not sleepe during nights ..suffering from severe gastric indigestion. Now his body is too hot getting warmer..amma please give my father good health, give him deliverance from all evil bondages,black magic and evil spirits.. Amma also give us transfer to a very far place from this lady..give us transfer to a good city in andhra region.we have a desire of Vijayawada amma..please give us transfer to andhra city which should be very far from this bloody lady who had done black magic to dad repeatedly for 3 times.. mahboobnagar 2015-05-06
swetha MA! YESTERDAY I CAME THERE TO SUBMIT MY PRAYER.NOT EVEN 24 HOURS IS NOT OVER YOU COMPLETE IT AND GAVE US YOUR BLESSINGS IN DOUBLE THANK YOU! SO SO SO SO MUCH. REMAINING ONE PRAYER IS LEFT THAT IS MY 10TH PUBLIC MARKS! PLEASE MA GIVE ME MORE MARKS THAN 490 PLEASE PLEASE!!! I AM EAGERLY WAITING FOR YOUR BLESSINGS AND ALSO I SURRENDER MYSELF UNDER YOUR FEET. HAIL MARY!!! dindigul 2015-05-06
m.rajendrann amma enakku vazhi kaattu thaye shosthirem chennai 2015-05-06
maniyan paramasivam amma. i am sorry for all my bad behaviors i did so far amma. i love you amma. i will be good and i will do good things amma. i nee you to be with me and bless me forever amma. i love you amma. i love you and i need you amma i will be good an i will do help as i said amma. i need to be perfect and very intelligent, everything should go fine, i should be very sharp and very very creative amma. i need you amma. please be with me and bless me forever amma. i love you amma. amma. i should be happy always and getting good names from everyone, very very perfect , very good concentration skills, and very much innovative amma. i love you amma. make my mind so so bright and clever amma. i love you amma. i really love you amma. and i will be good and i will do good things, and i will stop doing all these bad things amma. i need you to be with me always and bless me always amma. with your blessings maniyan paramasivam. i believe in you amma. make me so so bright and sharp and very fast learning abilities amma. noida 2015-05-06
S Dear beloved mother Mary, mother please help me, mother please save me from all the stress and tensions i am bearing now, mother as my child is not feeling well from 5 days my child is suffering from severe fever cold and cough , mother he is not eating well became very weak mother, mother please help my child now , mother as a mother u know the pain of a mother mother,mother please heal my child now, mother touch my childhood and heal my child now, mother please come into my life now, I need you mother please be with us always , mother please have mercy and heal my child , mother please do miracle now and heal my child, heal him totally whatever bothering him and bless my child with good health good growth and nice sleep through out the night , mother I beg you please grant my prayers now and bless my child now mother mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-06
Devotee Mother Mary, You answered my prayer Thanks for getting me the Documents back without any damage,I want to find a good job with the skill set that i learned, please secure my future and please help to get married soon.please secure my family,s future guide US. Devotee USA 2015-05-06
vinu thomas amme mathave njangale dinamprethi anugrahikkunnathinai njangal stothram cheyyunnu. njangalku annennu venda annavum njangale nannia samrakshikkunnathinum njangalku vendi angayude puthran thamburanodu mathyastham vahikkunnathinumayi njangal nanniyode orkunnu mathave. angayude kripa kadaksham njangalilundakaname. mathave. enikku nalla job avasarangal orukki tharunnathinayi angayode njan stothram cheyyunnu. KOCHI 2015-05-06
Michael Good Morning Ma, thanks and take care of all are need both spiritual and material Thanks Ma auh 2015-05-06
lavi Mother Mary Bless me, Please pray for my personal intentions.Thank you. uae 2015-05-06
Sheeba Amma,Please help my parents and my sister to build the compound wall around the plot and take the wood.Please give the protection also. Amma please solve this land problem today quickly.Please Amma.The opposite parties and the president are continuing the problem.I don't know how this problem solved ? when ? Please Amma.......... Kuwait 2015-05-06
himabindu dear mother we thank you for the blessings received. kindly pray to your beloved son our lord Christ to give strength and energy to bindu during these pregnant days. kindly touch and bless the child in the womb in its growth and development and free from all kinds of diseases, abnormalities and infections. hyderabad 2015-05-06
bindu dear mother we thank you for the blessings received. kindly pray to your beloved son our lord Christ to give strength and energy to bindu during these pregnant days. kindly touch and bless the child in the womb in its growth and development and free from all kinds of diseases, abnormalities and infections. vskp 2015-05-06
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my mom of good health. mother please bless us sort our family dispute. Mother please bless my mom of good health. Mother please bless my family peace n happiness. Mother please bless my dad eternal peace. Mother please bless us. mumbai 2015-05-06
M.Rajendran thaye un thunai shosthirem chennai 2015-05-06
M.Rajendran thaye un thunai shosthirem chennai 2015-05-06
Swetha mary Amma Please help Avinash family by giving them good health and helps his brothers to lead their life in good manner-and Help Kiran family in order to over come their financial difficulties and help him also to be well settled in his career and to be educated . Please grant them happiness in their family, help them to solve all kind of difficult situation .help all the human beings in the world to lead their life in a good manner. Bangalore 2015-05-06
s Please help me Amma from all kind of difficulties. Amen bangalore 2015-05-06
j I beg your powerful intercession to get a job in a good company with good salary,timing,leave and allowance. Amma you are the only person to recommend for me.Please bless me and my family. d 2015-05-06
asha MATHAVE ENTE MAKKAL INNATHE PAREEKSHA NANNAYI EZHUTHANE AVARE ANUGRAHIKKANE ENNE KAIVIDALLE kerala 2015-05-05
asha BLESS US WITH A SAFE JOURNEY TO VELANKANNI kerala 2015-05-05
smn Please pray for my husband HN and son LKN both of them are suffering from skin disease. Please heal them completely. DUBAI 2015-05-05
Nevin Clement My Mother Kusumam Clement is suffering from Cancer and is having severe stomach pain and vomiting for couple of days. Request Our Lady of Good Health to heal her and relieve her from pain and trauma. Thanks, Nevin Clement a humble devotee Aroor 2015-05-05
Franklin Dear Mother Mary, I am really nervous about my upcoming exams. I plead you to grant me confidence and concentration in preparing for my examinations and help me succeed in them. Please intercede for me to your divine son to grant me success for this exam and my career. I would be eternally thankful and grateful for this success which I will be receiving through you. Please help me to succeed in these exams with ease. The results should come in my favour. Thank you and Praise you Mother Mary! Praise the Lord Jesus Christ! United Kingdom 2015-05-05
SHANTHI AMMA PLS SAVE ME, PLS GIVE ME PEACE OF MIND... MY HEART VERY PAIN MA. THANK YOU SPORE 2015-05-05
Sheeba Amma,Please help my parents and my sister.Please protect my father's properties from opposite parties. Amma ,please scattered the opposite parties. Amma bless my parents and my sister Kuwait 2015-05-05
GB Mamma Mary, My daughter Cheryl is sick and having stomach pain since some time now. Please, please interceed to our Lord Jesus to touch her and heal her completely. I calim with faith that she has been healed. Thank you mamma Mary. dxb 2015-05-05
GEORGE.K.P. VELANKANNI MATHA PLEASE GIVE A CHILD AND GOOD HEALTH . NARAKAL, KERALA 2015-05-05
GB Mother Mary, my son needs a job as a summer trainee in Canada. Please interceed to our Lord Jesus to grant this request and also that he gets his Canadain citizenship soon. Everything is possible with our Lord Jesus Christ. We only look upon him for all the miracles in our life. WE would also like to give thanks to YOU and our Lord Jesus Christ for blessing us abduntanly. Thank you Mother Mary. Thanks you Jesus. We love you. dxb 2015-05-05
m Dear amma..we want transfer to andhra like vijaywada from this telangana..my father works in bank who suffering from witchcrafts done by a lambadi lady to kill my father. Amma amavasya is coming near by again she will repeat in doing black magic to my dad.pls stop that lady in doing these evil things to my dad.pls save my father's life and protect him from evil bondages. .give him deliverence from evil bondages. .and pls give him deliverence from all witchcrafts.give us transfer to a new place which should be very very far to this evil lady mahboobnagar 2015-05-05
GB Mother Mary, Our brother Manueal had a major surgery and we ask for a speedy recovery and to help his family financially. Please ask Lord Jesus to pour out his graces and blessing on them. Thank you. dxb 2015-05-05
john arockya annaye valka...mother mary pray for us amma my brother is suffering a lot.and you know how kind he is and how simple he living in the society.nan enakaga ethum kekala amma my brother nalla irukanum.avanga valkai nalla irukanum.please amma you know what they want now.ketkamal tharuginta thayala kunamudaya thaye enga annanuku nalla oru vazhi than neenga vachirupeenga nu theriyum..athu varaikum annanukum annikum nalla thairiyatha kudunga thaye.nallathu nadakum enta nambikai enaku undu...inuum koncham naal la nan nanti kaditham eluthuven. nagercoil 2015-05-05
Mohan I shoud regain my sight fully without surgery now. Gods name be praised canberra 2015-05-05
Brenda Thank you Mother Mary for all favours granted to me as when I was in trouble. Mother Mary of Vallankanni, Please help me to bring to your shrine, my mother who is a devotee of you, my daughter and my sister during this month. I want to fulfill my mother's wish. she is 75 years of age and is eagerly waiting to come to India. Please help me to find the necessary funds and fulfill my mother's wish. Sri Lanka 2015-05-05
V.christina Dear amma,tq listing my prayer,amma pls pray for my family amma please change my husband richard bad behavior to come good person and come back with me and wit my daughter, he leave me go 1 year ready amma,plase change him and come back wit me amma,plase pray for me amma, amen. malaysia 2015-05-05
M Banu Amma! Please pray for me. when will come my uncle son with me Amma! Please pray for his comming. I love him so much and my family also. Tuticorin 2015-05-05
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless my parents suresh and relatives train journey.give me government job amma.bless pond.thankyou amma. varahapatnam 2015-05-05
sojin Amme mariye.enikke ishttapedano enne ishttapedano aarum illa.ellavarum randum moonuvattam ishttapedunu amme.enneyum nallaro koche snehikkaname amme.enikke oru veedilla amme.enikke cheriya oru veeduvakkan vazhi kaanikkane.nalla oru joli sariaakki tharane.amme ente sankadangal bhuddhimuttayi thonnuvaanel enne konnu kalayaname amme adutha janmathil snehikkunnavarude.kaalukal kazhukan ulla yogathya tharaneme snehichittillathathukonda.kaivediyalle amme Kerala 2015-05-05
Thevaapriyaa Amma tomorrow at 9am I have Advanced Financial Accounting exam maa. Amma I have studied everything that my lecturer told me. Amma please bless me to get a very easy questions maa. Amma please bless me to do well all the questions maa. Amma for section A the marks is 40 maa. Amma for section B the marks is 30 for each questions maa. Amma I try my best to prepared well maa. Amma please bless me to do this exam well maa. Amma please bless me to answer all the questions correctly maa. Amma please bless me and be with me always maa. AMEN... Malaysia 2015-05-05
Mohan Sug Mother... please help to overcome the obstacles and make my dream come true.. bng 2015-05-05
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatuuna ella budhimuttukalum vishamagalum maati saukyam tharaname,athodoppam enneium ente pappa,mummy,anishchan,remiya chechieum,ashima moleum thirumunppil samarpikunnu aapathil ninnum anarthagalil ninnum rogathil ninnum viduvichu kaathukolaname.Amen Dubai 2015-05-05
m.rajendrann amma ennai athariyum thaye shosthirem chennai 2015-05-05
ra Ammeee. ... Please give me relief from all the pains. My muscles are paining severely. Make me fit. I don't want to live like a sick person. Give me relief fro physical and mental sickness.Thank you for all help and support Ammeè. Please don't forget to give guidence yo my youngest daughter in her studies and future plans. Please give her good results.AMEN yr 2015-05-05
harrish mathava e, i am sorry for i hurt my sister.i want to place in zoho i want to become like my role model. i want to my family happy about me.i dont want to hate or hurt anybody in my family.give shine to my sister and family and me.give me confidence.give full mind concentration to on my study.i want to study freely and i want to get 8.6 gpa in this exam... chennai 2015-05-05
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my dad eternal peace. Mother please bless my family peace n happiness. Mother please help us sort our family dispute. Mother please bless my mom good health. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless us of all happiness. mumbai 2015-05-05
H Sankaradhas Holy Mother, pray for us sinners. I am suffering badly from back ache for the past few days. It has become severe during the last four days. I am passing through a difficult phase for the past four years. I have just come out of depression after visiting Velankanni Church. Mother, the severity of pain (may be evil spirits too are adding to my pain) is becoming unbearable and and my wife to is getting distressed. You are my/our hope. Do not forsake me/us. Please heal me and grant us a peaceful life. Secunderabad 2015-05-05
Sheeba Amma,Yesterday ,the land problem didn't solve.The president and opposite parties were not allowed to complete messuare the plot.So the government employers told today we will come.But The opposite parties are telling to beat and valavidamaattom like this .Please Amma help my parents and my sister.please Amma solve this problem today.we are afraid that opposite parties .Please Amma you know my parents situation please amma help them.We wantonly my father's properties.But they are not allowing to meassure and build the compound wall.They are asking 2 cents like this.Amma you must not allow to build the rason kadai or any other to opposite parties.Please Amma you go to that place with your son.Amma guide my parents and my sister.please Amma scatter the opposite parties.Please Amma solve this problem quickly with peace. we don't want case ,court,police case and fighting. Please Amma help my parents and my sister and solve this problem today quickly............I want good news that is solved the problem. They are not allowing to take that tree. Amma come quickly with your son. Kuwait 2015-05-05
Eliza Ma, Good Morning Ma, Thanks and praise you for all your blessings on us. Help and grant us what we need. Bless my daughter in a very special manner to excel in all her papers and you correct all her papers. Bless my niece with a suitable life partner and job Bless my sister and clear her face, good health, peace of mind and touch her husband change from Saul to Paul. Bless my Mom with good health of mind and body. Give an understanding heart to my brothers to care my mom. Bless us with good health and clear all our debts and loans and help us to build a blessed home show us a good person in this aspect. thanks Ma. uae 2015-05-05
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-05
Sheeba Amma, the opposite parties are deciding to beat my father and surveyer and my father side people.please save them.please solve the problem today quickly. Kuwait 2015-05-05
J.Dominic Vijay Kumar Dear Mother Mary, WE thank you for another day and for blessing my daughter's first holy communion to go well and as planned. Please bless my aunty family with peace success and prosperity and bless there children and safe guard them from all evils, dangers and accidents and forgive there sins. Please bless my uncle soul to rest in peace. Mother Mary please bless me and my family with good health, good wealth, peace of mind and protect us from all evils, dangers and accidents and forgive our sins and forgive those who sin against us. My savior please bless my relationship with my boss my MD and all my team mates to be good and suceefull in all the work we do and please bless with good leadership qualities and help me control my ego, anger and dominance. Please forgive me for using abusing words and talking ill about others, please forgive me and clean my body and soul. Mother Mary please save my job ,my name and my dignity in this company and protect me form all evils,dangers and accidents and please bless me with better job ,better designation ,all my juniors have grown in life they have good designation and good companies I know this job is blessed by your grace but my savior this company has no growth, you know everything its only salary but only if we are in good terms and if my MD likes then only we get good increment and promotion. There is no professional growth,its only dirty politics and ego problems and issues. Am really feed up and disheartened. My savior please show me different job and I want go back to Chennai or Hyderabad or in Delhi only a better company which well known in the industry. Am really struggling here with no peace of mind and that enthusim is not there to work. Mother Mary please give me better company and well know brand and with your grace am getting good salary and most of my loans are cleared with your grace and I have done little bit of saving also with our grace. Mother Mary this more than enough for me and my family is also happy ,but some where am not happy with this company ,I see people humiliating me and insulting me so much and putting my dept. down. Please come to my aid and forgive my sins and forgive those who sin against us and please give me better job and am handling two major projects which needs to be implemented ,this very critical for me and my career, and before that I need to do prestation to my MD and he will so much of queries which I need to answer and then only we can implement that. Please give me confidence and strength to work hard and fulfill all my MD dreams and see to that he is happy since he my pa master and in one way he also responsible for my growth. So pls guide me and bless all my communication ,mails and meeting to be successful adn fruit full. this month with peace success and prosperity and I have started my novena till I get better job I'll continue my novena and once I get better job I'll come to your shrine and shave my head and kneel come to your holy tank. All my commitments to words the offerings for St. Antony ad your mother Mary will be fulfilled and please bless my wife with good health, give her all happiness and peace and protect her from all evils,diseases and please bless my family and make to be united always. In your name am ending this prayer and starting this day and this month and this week, Pls be with me always and bless me with peace and prosperity. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-05-05
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-05-05
Mary Ammae sthothram ammae aenniku exama nalla markodae njn vijayikkanaeammae enni njn fail avallae njn kashtapaettathu enikku nanayi upayogapaedannae amnae kaividallae nalla mrk vanjan avasaram undavannae ... K 2015-05-05
ESTHER Dear mother, Amma where are you, why you are not hearing my prayer request. please bless me mother, dont leave me alone. please bless my children s, Amma Please bless me HUBLI 2015-05-05
mary magdalene o gracious virgin Mary,thank u for giving me gud life ,gud parents and protecting me till this moment.Gracious Mother Mary u were with me all these 14 years of my school life. Mother Mary pls shower ur blessings on me at the end of my school days and to get gud marks and gud clg for the next part of my life..Hail mary,pls shower ur blessings on all students who are eagerly waiting for their marks tomorrow..i ask this prayer through CHRIST OUR LORD.AMEN neyveli 2015-05-05
SHANTHI ASOGAN TO AMMA, I PRAY THAT MY HUSBAND TAMILU WILL BE FINE AT WORK. PLS GIVE BOTH OF US PEACE OF MIND. PLS FORGIVE HIM AMMA. WE WILL COME TO GET YOUR DARSHAN SOO AFTER THIS PROBLEM SOLVE. PLS BLESS MY FAMILY. THANK YOU SINGAPORE 2015-05-04
IRENE ALEX IAM WORKING IN DUBAI VISA CENTRE BUSINESS HAS COME DOWN DUE TO HEAVY COMPETITION AND RATES ARE A PROBLEM WE HAVE TOUGHT TIME MAY IS SO DULL NOW IAM A ONE INDIVIDUAL WORK OH MOTHER I HAVE 14 YEARS EXPERINECE I HAVE 2 IATAS I HAVE 5 YERAS EXPERINECE +5 YERAS FOR DUBAI VISA ALSO IAM 46+ OLD UNMARIED MY WORK LIFE IS VERY TOUGH PLEASE SHOW A WAY TO GET MORE BUSINESS OH MOTHER PLEASE DO MIRACLES IN MY AFTER 1995 I HAVE NEVER COME TO YOU IAM THE ONLY CHILD OF MY PARENTS THEY ARE 77 AND 71 MY FATHER IS SICK WITH SWELLING IN HIS LEGS SINCE HE WAS NOT WILLING TO COME TO A DOCTOR WE HAD TO DOCTOR ON CALL AND IT IS ONE MONTH NOW WHAT IS THE SOLUTION OUR HOUSE IS PLEDGED HE USES THE FIRST FLOOR ROOM SO TO CLIMB STEPS IS VERY TOUGH FOR HIM HE HAS EISONOPHILIA HE HAS LESS SODUIM HAEMOGLOBIN PROTEIN HE HAS BP HE IS SO THIN HE HAS ALLERGY ISSUE OH MOTHEROF HEALTH FINANCAILLY WE HAVE SO MANY ISSUES OUR OWN HOUSE IS PLEDGED IN THE BANK ALMOST 8 LAKHS OUR HOUSE IS 25 YERAS OLD NO MONEY TO DO MAINTAINCE WORK ALSO WE HAVE PLEDGED GOLD WORTH 77700 ALSO FOR WHICH WE GIVE INTERST I HAVE TAKEN LOAN ALSO 56000 IS BALANCE MY MOTHER HAS NO BANGLE NOW IA ALAWAYS FIGHT WITH MUMMY OH MOTHER THINGS ARE NOT OK AT HOME AT THIS STAGE WHAT IS THE SOLUTION FOR ALL OUR PROBLEMS MY SALARY IS 18700 IT IS NOT ENOUGH I SUPPORT MY PARENTS AND MY EXPENSES ALSO OH MOTHER WHEN I COME TO OFFICE THIS MONTH ON A MONDAY BUSINESS IS SO LESS WHAT WILL I DO TO SURRVIVE I HAVE NO BROTHERS A ND SISTERS PLEASE PARY FOR ALL MY PROBLEMS THAT WE FACE IN LIFE ANCESTRAL PROPERTY IS SOLD ALL MY FATHERS RETIREMENT BENEFIT IS OVER E HAVE NOT GIVEN ANY SHOP OR HOUSE FOR RENT SO ADDITIONAL INCOME IS NOT THERE WE STAY IN ERNAKULAM IAM IN NEED OF YOUR GRACES TO BE SHOWERED ON OUR FAMILY PLEASE SHOW A WAY TO COME AND VISIT YOU OH MOTHER WITHOUT FINANCE NOTHING CAN BE DONE MY MARRIAGE GOT DELAYED BECAUSE OF MONEY MY HIGHER EDUCATION OUR HOUSE HAD TO PLEDGED NOW MY FATHERS SICKNESS ernakulam 2015-05-04
ra Ponnu velankkanni mathave. ..Why nobody respect me? Is anything wrong with me? I don't think I hurt anybody intensionally. Please forgive me if I did anything wrong and make me a good person.please make me to talk to everybody nicely and use the apt words.Please help me Amme....AMEN yr 2015-05-04
ESTHER amma i am help less HUBLI 2015-05-04
Nancy Please pray for my sister Mavis and my daughter Anna to get a suitable job, they are jobless from so many months, please pray for them to get a very nice jobs. Please also pray that the money invested by me in the building at HDIL in palghar is refunded to me back as there is no progress in the building from more than two years. Please also pray that our building projects starts in our chawl Mamta Kutir. Mumbai 2015-05-04
Sonal O Lord Jesus, first thanksgivings for all the favors received. We plead and pray as a family for a miracle to happen for my Dad, Mr. Dsouza as he is diagnosed with Cancer. While doctors state that it cannot be healed through medical aid, we believe completely in your aid, O’ Lord. Please touch him, cure his illness and heal him completely as a miracle. Also, we pray for my mother, so that she is filled with courage and can take care of my father to the best, as well as bless her with good health. Be with our entire family at this difficult times, Lord so that we are strengthened and united as one family always Lord, forgive all our sins, bless us and please hear this prayer for our dad! AMEN Mangalore, India 2015-05-04
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless specially nanna today his birth day amma bless him amma.give me government job amma.bless pond amma.thankyou amma. varahapatnam 2015-05-04
r dear mother I beg you help cl to get the money which is short in the accounts or he has to pay from his pocket why mother all these problems for us open some door for cl to change his job as this is yr blessing pls don't trouble us lord for this help us in our finances we have no where to go children school will be problem whom to go how can we manage only yr our help help me to loose weight I beg you mother help us for cl working situation you be there with him at all times guide take away his tension and ease and cool his mind take care of the situation help him for his job bless us mother I intercede with yr son and his precious blood for this request. also help for the road shipment to be all in order for both jerr and linnet m 2015-05-04
ra My dear Amme. .. Please please help my youngest daughter. ..Please motivate her and help her to memories and write th exams very well and score higher grade. She is trying her best to study . Please. .please give her luck. Thank you for your help and support. Amen yr 2015-05-04
Sheeba Amma Please help my parents and my sister.They are in difficult .because of the land problem. Please guide them and bless them .Please Amma.... Kuwait 2015-05-04
paulraj Amma Madha, Please pray for me to rejoin the job in Dell and continue to work in Dell in USA with the same visa and continue to stay with my family in this country. Pray for my son to get good life, long life, good studies and pray for him to complete 11th and 12th grade in CRHS and college in University of Texas. Also I pray that I will receive Green Card and excellent job promotion and salary. Please pray for me Velankanni Madha to your son our Lord Jesus Christ Amen. USA 2015-05-04
ak Dear mother first tanks to jesus for all things and pls pls give peace to mum,dad,sister and me i want to see my sister but due to some reasons Dat means he isvquite busy vit some work my dad wont agreeing to go dere pls change his mind mother pls pls pray To avay davuda in d name of jesus ....Amen g 2015-05-04
mrudula Dear amma..my father has been suffering from witchcrafts done by a lady to kill him. .his health is not good..indigestion not eating properly.. Suffering from severe knee pains, joint pains..please give him deliverance from all witchcrafts and evil bondages. And also my father applied transfer to Hyd but no one is helping us,and they are saying its impossible for u to get transfer to Hyd..amma pls give transfer to Hyd so that it will be near to hospitals, and Sunday different masses to attend organized by different speakers..pls save my father life from that lambadi Lady's hand mahboobnagar 2015-05-04
veronica rodrigues mumma Mary from last 4 yrs I am struggling to become a mother and,I have Faith that this yr I am going to become mother......pls prayer for me as my mother in law is getting tense when I will conceive because of this tension het bp goes high and become low after 2 2 3 days I am worried abut her.....plastic do keep me in your prayers amen..... mumbai 2015-05-04
m.rajendrann thaye neeye thunai shosthirem chennai 2015-05-04
C R Babu Amma Velankkani Mada today is fourth day and still no news about Schengen visa for my daughter. We are desperately waiting for the same and I humbly beg plead and pray from the bottom of my heart for merciful blessings from God for my daughter's Schengen visa . God we beg and seek blessings of Amma Velankkani mada's in getting visa for my daughter to visit France and meet her husband. God bless us with the visa please Kochi 2015-05-04
nivya Mathavae aenniku exam easy akkanae kripa thonni ee pravashyam njn passavannae mathavae aenniki vaendi prarthikksnae kathurakshikkanae nannayi pass avanae kaividalllae ammae tr 2015-05-04
nivya Mathavae aenniku exam easy akkanae kripa thonni ee pravashyam njn passavannae mathavae aenniki vaendi prarthikksnae kathurakshikkanae nannayi pass avanae kaividalllae ammae tr 2015-05-04
smreeti Dear mother, Please fullfill my wishes what i want....i am doing my best to get all of them. Please be with me and shower your blessings. Give me strength to face all the hurdles and challenges whatever i am going through in my life......... i believe in you and i know you listening to me. Thanks Your daughter banglore 2015-05-04
Baalachandiran Kunaratnam,Canada, Amma please heal my shoulder pain and do miracle for our financial hardship. Canada 2015-05-04
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
S Dear beloved mother Mary , mother please help me , mother please save me , from all the stress and tensions I am bearing now, mother as my child is not feeling well ,my child is suffering from severe depression fever cold and cough from 3 days , mother he didn't had food , mother please heal my child , mother touch my child now and heal him now mother, mother as a mother you know the pain of a mother mother please help my child and heal him now, mother please have mercy and heal my child , mother do miracle and heal my child , heal him totally whatever bothering him now and bless my child with good health good growth and nice sleep forever amen , mother please heal my child and bless him always mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-04
vinu thomas amme mathave njangalku divasavum tharunna kripaykayi njangal sthothram cheyyunnu. njangal anubhavikkunna kashtapadukalil ninnum budhimuttukalil ninnum durithangalil ninnum sambahathika njerukkangalil ninnum njangale karettaname ennu apekshikkunnu. njangalodu karuna cheyyaname amme KOCHI 2015-05-04
n Please amma intercede for me please unite me and shobu in marriage please amma karntaka 2015-05-04
Ranee Dear Mother Thank you for all the help you have given to me and answer my prayers.Mother I am coming to you again for help. Mother both my kids will be sitting for their mid exam next week.Pls help to obtain good result, be with them mother. Mother lately I am facing some finacial difficulty pls help. Pls help my hubby to get a transfer from this current branch.Pls mother help him as he cant take the humilation in his office.Pls help me with my job too.Mother pls help with my kids who are very subborn. Malaysia 2015-05-04
Ranee Dear Mother Thank you for all the help you have given to me and answer my prayers.Mother I am coming to you again for help. Mother both my kids will be sitting for their mid exam next week.Pls help to obtain good result, be with them mother. Mother lately I am facing some finacial difficulty pls help. Pls help my hubby to get a transfer from this current branch.Pls mother help him as he cant take the humilation in his office.Pls help me with my job too.Mother pls help with my kids who are very subborn. Malaysia 2015-05-04
Sheeba Amma My parents and my sister facing too much problem because of the land problem.The president and opposite parties are disturbing.Yesterday One big tree was fall down.So many government officers came.But the problem was not solved .So today they come.The opposite parties are asking "this plot is purampokku nilam and so we want 2 cent for construct a buildingand they are telling you are two girls only". Amma you know the true. How much problem were faced my parents for this land. Please Amma you come with your son and help my parents and my sister.Amma you must not allow to give land to opposite parties.You talk with the government officers.and guide them to messaure the plot.please Amma, solve this problem today without fighting ,case,court,police etc.we solve this problem with peacefully .The president and other parties are hurt my parents and my sister.please Ammm.....We want make a compound wall around the plot.Please help them they are alone .How this problem will solve? You can do very easily.We are believing you and your son.So please come quickly Amma.We all are scared. Amma,Please Ammmmmmmmaaaa......... Yesterday,that big tree was fall down with simple wound for one lady.Thank you so much for this.If without you it could make big loss.Cure that lady and thank you so much Ammma.................. Kuwait 2015-05-04
IRENE ALEX please pray for my business for the month of may iam doing dubai visa applications numbershave come down there is heavy competion and rate issue we have no sales team also people prefer other destinations also what is the solution my company will not allow iam very anxious and afraid iam feeling bored please pray for me the present workplace and collegues for me is not easy iam 46 i get only 18700 with 14 years of experience this is not enough for me to manage please find a solution we are facing tough time oh mother why are you not doing miracles in my life for a woman 46 is a age when she should be settled with house husband and children in my case i have nothing iam still unmarried our house i spledged in bank 25 yeras old my father is77 and mother is71 my fathers income 12000 per month we are unable to run the show unexpected expenses will come oh mother i have loan for 58000 77700 amount gold is pledged in bank for which i need to give interest connveyance amountexpenses are tthere medicines also oh mother people have money are progessing in life please pray for me what is my future i have no saving at all only grey hair and weight gain girls of my age have big children in front of society we have nothing to say at all iam in kerala ernakulam 2015-05-04
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life,. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension, good house, good increment good promotion good house. Mother please bless my dad eternal peace, Mother please bless us sort our family dispute,. Mother please free avi n me of all worries n tension. mother please bless avi n me good health n job satisfaction,. Mother please bless my mom good health. mumbai 2015-05-04
ESTHER Dear mother, Please help me mother. I am helpless. HUBLI 2015-05-04
Michael Austine I am working as Accountant in Dubai.I have applied for renewal of my passport.Please pray for me to get the passport in hand and come for vocation on next month June to Tamil nadu. I have to take medical checkup in Tamilnadu. I am from Tirunelveli Dist.Tamilnadu. I along with my family will come to Vailankanni next month. Yours sincerly, Matha bakthan, Michael Austine Dubai 2015-05-04
sonia My name is Sonia my dad name is dhandapani my dad is suffering from kidney failure and under going dialysis please amma cure my dad's health problem as my dad is back bone of our family no relative support ... Please my dad must come out of dialysis and cure his kidney failure plz I beg u Amma we are believing u only Annai Maria wipe our tears we beg u lot amma cure my dad's health Bangalore 2015-05-03
buntymanish That He would give you a heart for His ways. Secunderabad 2015-05-03
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-05-03
mahesh Dear ama please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me job amma.bless my village amma.thankyou amma. varahapatnam 2015-05-03
2015-05-03
irene alex Iam in ernekulam please pray for me and myold parents ernakulam 2015-05-03
2015-05-03
Ku Ching Wei Deborah Our Canada paper are being in process and we hope it goes through and we get to know by this month. Pray for my cousins-Andy, Joanna, Melanie and Samantha passed their board exams with flying colors. I hope I get pregnant before I turn 35yrs old. Hopefully I get some jobs in Dubai/Sweden if things not working out for Canada. Pray for Nepal, those who have loss their love ones. May their soul rest in Peace. Amen!! kolkata 2015-05-03
lourdes my deceased husband was unfaithful to me and I only came to know after his death.he has left me with debts and old house to repair with a court case and a minor daughter to take care.please pray I may be able to forgive him for the amount of trouble he gave me and success in court case and a healthy life for my daughter. mumbai 2015-05-03
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER PLEASE HEAL MY FRIEND DURGA PRASAD FROM ALL HIS SICKNESS AND PROTECT HIS FAMILY MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-03
SM Please pray that SS has no problem, that I can travel safely, that J leaves easily without any demands and that I have a safe journey also that RSV has a safe pre and the baby and she are safe. kk 2015-05-03
soney koshy st mary please pray for bringing my wife swapana to kuwait soon.interfere in her personal life, her financial situation is bad and father is contracted stroke and bed ridden.please pray for healing his decease completely.swapna be begotten a baby boy soon . abbassiya 2015-05-03
S Dear beloved mother Mary , mother please help me , mother please save me from all the stress and tension I am bearing now, mother as my child is not feeling well , my child is suffering from severe fever cold and cough , mother he didn't ate anything from two days , mother please help my child , mother please heal my child , mother touch my child now and heal him , mother please heal my child now mother, mother as a mother u know the pain of a mother mother, please heal my child now mother and bless my child with good health good growth and nice sleep through out the night, mother please heal my child now and bless him me and all my family with good health peace and happiness forever amen, mother I beg this and I pray this in your precious name mother amen. bangalore 2015-05-03
Tom Czerwinski Prayer Request to saint mary , there is this guy at my current company we deliver medications for mckesson canada and this guy ompal wants to do some bad changes and we don't want it , prayer request for ompal of mckesson canada in jesus christ name EDMONTON SOSNOWiEC 2015-05-03
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER PLEASE HEAL MY FRIEND DURGA PRASAD FROM ALL HIS SICKNESS AND PROTECT HIS FAMILY MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-03
latika Mother, thank you for all that you have given me so far. He is returning tomorrow. Please bless us to get marries and have a great life. secunderabad 2015-05-03
vinu thomas amme mathave, njangalku nee thanna anugrahathinum kripaykumayi njangal ninnodu sthothram cheyyunnu. amme njangal vale njerukangalilum sambathika budhimuttukalilum kashtapadukalilum irikkunna samayamanithu. njangalude avasthakalkku mattamundakkitharanamennu angayodu njangal apekshikkunnu mathave. njangalku vendi angayude puthran thamburanodu mathyastham apekshikaname amme. KOCHI 2015-05-03
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married. mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment. Mother please bless my dad eternal peace. Mother please bless my mom good health. Mother please bless avi n me of good health n job satisfaction. Mother please free avi n me of all worries n tension. mother please bless my family peace n happiness. Mother please bless my mom good health. mumbia 2015-05-03
Michael Ma, Good Moring and thanks for all your blessings and graces you have showered on me and on my family, bless my Church, home office kit and kins and all around the world. Ma, bless that little girl and ma, bless my daughter in a very special way and strengthen her with peace of mind and help her to speed up her studies and retain all that she studies and excel in all her papers and you please correct all her papers. Ma, bless my mom, husband sisters, niece myself and my land auh 2015-05-03
dhevayani i dhevayani has taken baptism want to have a lordfearing boy for marriage at present noy having goodjob plzpray for my permanenet job and my father is in debt plz save him jesus mumbai 2015-05-03
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-05-03
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-05-03
Shwetha Mother Mary please help my dad, mom and sis from financial problem and give them strength to solve all the difficulties and bless them with good health, And Help me to get good job and my Life partner as Johnson. Please Amma Pour your blessings in order to gain success and we love you Amen. Bangalore 2015-05-03
n Please amma unite me and shobu in marriage and his and my parents agree for an early marriage and I clear my moh /dha in my first attempt and secure a good job there amma intercede for me please karntaka 2015-05-03
C R BABU Amma Velankkani Mada I beg plead and pray to God to seek merciful blessing in getting Schengen visa for my daughter to visit France and meet her husband.Amma Mada please bless our wishes which we humbly seek Kochi 2015-05-03
C R BABU Amma Velankkani Mada I beg plead and pray to God to seek merciful blessing in getting Schengen visa for my daughter to visit France and meet her husband.Amma Mada please bless our wishes which we humbly seek Kochi 2015-05-03
C R BABU Amma Velankkani Mada I beg plead and pray to God to seek merciful blessing in getting Schengen visa for my daughter to visit France and meet her husband.Amma Mada please bless our wishes which we humbly seek Kochi 2015-05-03
n Please amma unite me and shobu in marriage and his and my parents agree for an early marriage and I clear my moh /dha in my first attempt and secure a good job there amma intercede for me please karntaka 2015-05-03
IRENE PLEASE PRAY FOR MY BUSINESS FOR THE MONTH OF MAY WE HAVE SO MANY FINANCIAL ISSUES MY FATHER IS77 AND HE HAS SWELLING IN HIS LEFT LEG AND IT IS NOT HEALING IAM 46 UNMARRIED OUR OWN HOUSE IS PLEDGED IN BANK WE HAVE GOLD PLEDGED IN BANK TOTAL 77000 I HAVE 58000 LEFT FOR HDFC LOAN MY SALARY IS 18700 IT IS NOT ENOUGH MY FATHER PENSION IS 5250 WE GET 6500 AS INTEREST FROM HOUSE PLEDGED IN BANK MY WORK PLACE AND COLLEGUES ARE NOT OK FOR ME IAM NOT HAPPY AT ALL I CAME TO YOU IN JAN 1995 IT IS 20 YEARS NOW THAT I HAVE COME IN 1997 I REJECTED FEWPROPOSAL AND AFTER THAT MY FATHER STOPPED SERACHING FINANCIAL ISSUES AND FATHERS SICKNESS IS MAKING THINGS A BIT UNHAPPY ernakulam 2015-05-03
m Dear amma..my marriage settlement is very problematic.boys side are torturing us amma...boy and his dad are torturing us with their behavior ..please help us to get rid out of this problem thnq.. mahboobnagar 2015-05-03
Anoj philip Mother mary amme im trying to migrate to canada since 3 yrs until now im not able amme please pray to god for getting good score for the getting canadian visa for permenet resident amee on 9th may im attending ielts test i need 7.5 amme then only my i can score good marks pls amme pray for me to god ammee this september im comming to india i will come to velankanji church and pray for 1 full day i believe i will get my visa and also 7.5 in ielts test me and my wife will come to church and pray and i will shave my hair and rest of my life i will live with prayers ...ammee pls pray for me ,my famil all those who are sick,siners,childrens muscat 2015-05-03
A.Sushmitha Agnes Oh Dear mother mary, im in need of your urgent help ma.. as you know i have applied for the post of store keeper. Bless me to get the job ma. I know you will not leave me as unkown. So please mother help to get the job. Today now my husband has gone to send the post .Let me receive the call letter in your blessing. And let all this happen only if it is according to the your wish and your beloved son ma. Chennai 2015-05-03
shiny please pray for my children ,my husband and all in the family, special prayer request for our vikar. mother mary pray for us india 2015-05-03
n please amma unite me and shobu in marriage and his parents and my parents agree for early marriage please amma intercede for me please karntaka 2015-05-03
stephen c Dear People Of God, Please pray to Jesus, Mother Mai to bless all my work for this week to go smoothly. Thank you Jesus Praise you Jesus Love you Jesus. Stephen A Servant of Jesus. Mumbai 2015-05-03
Swetha mary Lord we are 4 in family and i am the elder daughter and ma younger sis is studying and mom is house wife, we are very much troubled from our neighbour's and my dad as undergone an Open heart surgery in the 2012, and it is already been completed nearly 2 and 1/2 year but he is very scared to go for work, and we have taken loan from the bank and now it is very difficult to pay, and there is no peace at home also please pray for our family in order solve all the problems. and i am very much confident that ma beloved mother mary will help me. Amen bangalore 2015-05-02
b Dear Mother pray to my Jesus to rescue my husband amicably, safely and peacefully from the bondage of extramarital relation and to restore our marriage in love and fidelity. I pray in a special way for the other woman that she may be filled with wisdom and move out of this relation peacefully and may Jesus comfort and bless her. May Jesus wash away her desire to continue with my husband and of him marrying her. Please Jesus save us of this situation and help my husband come out of it. Mother dear please pray to your son Jesus to help us and end this extramarital relation peacefully. Amen. Mumbai 2015-05-02
Rosy Amma please help my sister to get Johnson as her husband and let them marry by this year (2015) without any problem. we are seeking your blessing for the auspicious day and please help us to get him as her life partner. Amen Bangalore 2015-05-02
S Amma please help my dad, mom and sis in order to get rid from all the health and finance problems and let them live a happy and prayerful life. Lord please my family to get your blessings in order to solve all the problems that they are facing each and everyday. And please help me to get my beloved partner. We love you Amen. Bengaluru 2015-05-02
AV Praise you Amma and we love you Amma. Pour your blessing on my family . Bang 2015-05-02
Sandeep Holly Mother Mary, Thanks for helping me in getting good accommodation at low price and mobile data for my work. Help me in studying and learning all the required things in the project i am working and enable to survive for my future. Chennai 2015-05-02
Ancy sijo Amme oru swapnaveedu paniyuvanulla alla swkaryvum orukitharaname amme.nattil pokumbol kayarikidakan oru veedu orukitharaname Amme .oppam oru chariya jobinayi try cheyunudu .anniku yogichathaneghil tharaname amme .kaniyaname amme annil .amen NewDelhi 2015-05-02
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope and Love. Please do not forsake my loved ones. Amen. --- 2015-05-02
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless me and vijaya specially todaywe are celebrating marrage day bless us amma.thankyou amma. varahapatnam 2015-05-02
Terence Noronha Please pray for Husbands job as they are restructuring his department. ..Please pray tat he does well in his exams and also to all his colleague who are going thru the same.and they all do not loose their job's dubai 2015-05-02
Terence Noronha Please pray for Husbands job as they are restructuring his department. ..Please pray tat he does well in his exams and also to all his colleague who are going thru the same.and they all do not loose their job's dubai 2015-05-02
LEELAVATHY Oh mother please hear my prayer. As I am married and I got 1 daughter she is 16 yes and she is a special child. Now knowy my house problem as she is unfortunately. My sister she is creating so many prblms to my entire family. We r helpless. Where ever we go for help she and her husband are giving money to them and they all become non supportive to us. Mother protect our house and return to my father and mother. Save us from those two thrives. As their torture we cannot tolerate anymore. Mother u know abt us can't u help us. Case should decide on our behalf. As my parents they r seniors citizens. Oh mother please help us save us . I cannot err explain in detail but those two frauds. Let the case be in our side. Please mother help us. Holy Mary pray for us. Bangalore 2015-05-02
LEELAVATHY Oh mother please hear my prayer. As I am married and I got 1 daughter she is 16 yes and she is a special child. Now knowy my house problem as she is unfortunately. My sister she is creating so many prblms to my entire family. We r helpless. Where ever we go for help she and her husband are giving money to them and they all become non supportive to us. Mother protect our house and return to my father and mother. Save us from those two thrives. As their torture we cannot tolerate anymore. Mother u know abt us can't u help us. Case should decide on our behalf. As my parents they r seniors citizens. Oh mother please help us save us . I cannot err explain in detail but those two frauds. Let the case be in our side. Please mother help us. Holy Mary pray for us. Bangalore 2015-05-02
ak Mother pls pray to jesus for my family expecially for my mumm and dad pls give pease to them dats only happy to me.. Mother pray to jesus for my wishes u know very jesus...pls ... Amen g 2015-05-02
M.Rajendran amma neeye thunai shosthirem chennai 2015-05-02
C R Babut Amma Velankkani Mada I beg plead and pray to God to mercifully seek blessings for.daughter in getting Schengen visa to visit her husband. Amma I beg with all humility to bless us with this humble prayer kochi 2015-05-02
David my two sons suffering from fever with cough please cure their sick matha please. please thucklay paracode kanya kumari district pin 629175 2015-05-02
Paul Jose Moolan Request for prayers to get permanent residence in Canada. st catharines 2015-05-02
Solis P. Nogot, Jr. Please help my son sundry passed the civil service exam he had today, maramimg salamat po. Ragay. Camarines Sur, Philippines 2015-05-02
BALAJI PARAMESH I want job satisfaction, improvement in work life, personality development, career growth, more friends connections, improving communication skill and working hard and achieving more in life. Clutterless mind, get out of waste.Protect all family members from the evil and help us to get into the completely well planned family mode. Very Happy and prosperous marriage function. NAGERCOIL 2015-05-02
2015-05-02
2015-05-02
LEELAVATHY Oh mother please hear my prayer. As I am married and I got 1 daughter she is 16 yes and she is a special child. Now knowy my house problem as she is unfortunately. My sister she is creating so many prblms to my entire family. We r helpless. Where ever we go for help she and her husband are giving money to them and they all become non supportive to us. Mother protect our house and return to my father and mother. Save us from those two thrives. As their torture we cannot tolerate anymore. Mother u know abt us can't u help us. Case should decide on our behalf. As my parents they r seniors citizens. Oh mother please help us save us . I cannot err explain in detail but those two frauds. Let the case be in our side. Please mother help us. Holy Mary pray for us. Bangalore 2015-05-02
2015-05-02
BALAJI PARAMESH Amma please bless me for a happy married life and bless me to drive safely. NAGERCOIL 2015-05-02
Michael Ma, I thank for all your blessings & graces you & your beloved son showered on us. Ma, take care of my daughter very specially & grant her good health of mind & body & strengthen her with holy spirit to face her exams well. Ma give her easy papers & u correct all her papers. bring a suitable life partner for my daughter & niece., bless & take care of my mom, protect & bless our land, bless my sister with good health & clear her face. bless me & my husband with good health clear loans for us. auh 2015-05-02
Your Devotee Mother Mary, Please find a good job for my brother please secure his future, he is your sheep, guide him. Devotee USA 2015-05-02
ESTHER Amma please help madama tahi. nana dudoo sigo hage madama tahi. amma please help madama tahi. HUBLI 2015-05-01
daughter Mother please pray for me to be free from the doubts my husband keeps having for me ... remove his mistrust and doubts, help him to have love and belief... mother please... pray for me ... i am tired.... ad 2015-05-01
2015-05-01
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless my parents journey.give them good health.bless my pond amma.bless me and get government job amma.thankyou amma. varahapatnam 2015-05-01
FRANCVAH JAMES mother iam coming on 5th of this month i want to come to you without any stick support i should walk and come to you mother this is the only request from me pray for me hyderabad 2015-05-01
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-05-01
JAMES FRANCVAH EACH AND EVERY ONE PRAY FOR ME THAT I SHOULD STAND IN THE PRESENCE OF MY MOTHER WITHOUT ANY SUPPORT hyderabad 2015-05-01
2015-05-01
C R Babu Amma Velankanni Mada I beg plead and pray to God for merciful blessings in getting visa for my daughter to visit France and meet her husband. Amma please don't let us down and I beg and pray not to punish her for no fault of hers Kochi 2015-05-01
Mohan Sug Please bless us with baby boy and everyone in my family with good health ... thank you mother... bng 2015-05-01
2015-05-01
Mohan Sug Please bless us with baby boy and everyone in my family with good health ... thank you mother... bng 2015-05-01
Mohan Sug Please bless us with baby boy and everyone in my family with good health ... thank you mother... bng 2015-05-01
sura Dear Mother ,Please pray for me to get a good buyer for the land we are planning to sell, also mother please help me find a job as soon as possible or otherwise our financial position is getting very bad .Amen syd 2015-05-01
sojin Amme enne kaivediyalle.enikke oru veedu vakkan sahayikkane.enne snehikkan aarum illa sneham arinjittilla amme snehikkan nalloru penkochine tharename pappedem ammedem aagraham nadthename aniyathikkum enikkum oru nalla joli tharaname.amme kaivediyalle njan kaalupidikkam.amma kaividillaennariyam.amme tharename kollam 2015-05-01
J.Dominic Vijay Kumar Dear Mother Mary, Please forgive me for not attending the new year mass please forgive me and my family for doing this ,my savior I beg you this year has started in very bad way, please come to my aid and save me and protect me and my family ,mother Mary my savior please give give strength to my cousins and my aunty to bear the loss of my uncle who passed away in the evening ,my savior I had always asked to protect that family and show them way and guide there kids in good way ,my savior what happened today those kids are without any one on there head. Please give me strength to bear this loss of my uncle who has helped me so much and always was with me to support and protect me.my savior I need your blessing and grace to save me and my family from all evils, dangers and accidents and please bless my daughter's first holy communion to go well without any further problems ,this day will be remembered thought out my life ,please don't punish us like my savior as committed I'll do all my offerings ,please give me strength to work hard and my savior on Sunday am going to Bangalore to see my uncle for the last time ,please come to me and protect me from all problems issues and please help me nad my family ,mother Mary my daughter is so depressed and her dreams her shattered ,why did this happen ,please mother Mary am really scared what all is going to happen this year ,please bless every one with good health, good wealth ,peace of mind and please bless there family with good health and unity and save them from all evils accidents and forgive there sins and forgive those who sin against us. Mother Mary I trust in my prayer and my rosary please bless my family in my absence and please bless this holy communion to go well with your blessing and grace.Tomorrow my daughter will attain the holy spirit please bless her guide her and show here path and save her from all evils, dangers and accidents please give her long life. Mother Mary please save my job and my name and dignity in this company ,I need your blessing and grace please bless my relationship with my MD my boss and all my team members. Please forgive me fro being so rude and aragonite with my aunty ,pls my savior I beg I'll never be like this in my lie again ,please forgive me and save me and my family ,mother Mary only you can save me form this problems ,please bless my aunty and my cousins so that they at least get some money for there survival ,for us your the only source for divinity and protection. Please give her strength pls be with her and with my cousins and pls give my brother full strength o handle everything properly .I fall at ur feet and ask you for forgiveness and I promise i'll never do such things in life again.in your name and grace am ending this prayer and going to blr on 3rd and returning back on 4th of may till then safe guard my job ,my family and my cousins and my aunty. For us its only you who can be with us when we are in distress and pain. Please bless my daughter's holy communion to go well without any problems and pls be with her and pls give us strength to make this holy communion a success though we are morunign my uncles death. Please bless his soul to rest in peace and bless them so that everything goes well. IN your name am ending this prayer. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, rgds, J.Dominic Vijay Kumar Delhi 2015-05-01
devotee Mother Mary, Thank you mother mary for getting me the passport please get me the other documents without any damage Please secure my future and find me a partner in my dream Devotee USA 2015-05-01
ak Mother chusava em jarigindo ipudu how davuda pls teach him lession.... k 2015-05-01
M.Rajendran ella kulappankalukkukm kavalaikalukkum theervu kodu thaye shoshthirem chennai 2015-05-01
SM Please pray for SMV's good health. Please pray that my huband is fully healed and comfortable and that both sales take place immediately and that both Paandhus and Chsemo are humbled and do not give me any kind of trouble that SS is victorious at work and is safe and in good health also that my full p reaches me immediately and there is no problem in my muhome. Please pray for Abe's good health and healing. kk 2015-05-01
Claudia Dear amma ,thank you for watching over my kids ,please keep my daughters eyes and joints clear of cells and inflammation ,please care for my sons fever and illness ,thanks again for caring my family ,I will visit you soon with family . Us 2015-05-01
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER PLEASE HEAL MY FRIEND DURGA PRASAD FROM ALL HIS SICKNESS AND PROTECT HIS FAMILY MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-05-01
n Amma unite me and shobu in marriage please amma intercede for me and his parents readily agree and I clear moh/dha in my first attempt and securea good job karntaka 2015-05-01
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi and me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. Mother please bless my mom good health. mumbai 2015-05-01
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-05-01
Roche Victor Maria Doss Nandri Madhavee.. Amen Chennai 2015-05-01
ESTHER Amma please help me mother. HUBLI 2015-05-01
ESTHER Amma please help madama tahi. nana dudoo sigo hage madama tahi. amma please help madama tahi. HUBLI 2015-05-01
saritha amma Madhave please bless me that i should deliver my baby without any complications & it should be safe. please i beg you that i give birth to a girl baby & name her as maria first, please thaye i plead you to grant my request amma. from the say i conceived i am pleading you for this. please grant it to me thaye. please protect our family from all evils & grant my wish & request amma madhave thaye. bangalore 2015-05-01
n please unit shobuand me in marriage karntaka 2015-04-30
n please unite shobu and me in marriage please amma karntaka 2015-04-30
ESTHER Devate Velankanni mathe, Amma please nanage sahaya madu tahi. amma nanu kalidukondiro 60000/- sigo hage madu tahi. nanage yakistu tondare tahi.amma.......................................please nanage ella novinda doora madu tahi.Amma nanna ella tapanu kshmisu tahi. Amma please kapadu tahi. HUBLI 2015-04-30
Kavitha Henry Mother mary pls have mercy on me amma pls help in the money amma I should not have any problem like money amma ,,tomorrow is my son's 1st year birthday amma pls bless him and he should come up in is life super amma with out any problem he should be a great boy amma pls help him in is study amma always be with him and guide him what and all is doing amma pls help him and bless him amma always your blessing should be with my son and daughter and in our family amma don't leave our hand always you should be there amma help amma bless us soon I should get one good shop amma pls bless us amma Amen. bangalore 2015-04-30
Dency Binu Kindly bless us with a baby.......... Dency & Binu Kochi 2015-04-30
Dency Binu Bless me to clear CMA final examination Kochi 2015-04-30
john fernandes praying for a save trip to vallankanni with my family santa cruz 2015-04-30
john fernandes praying for a save trip to vallankanni with my family santa cruz 2015-04-30
DAVIS FOR FAMILY PEACE.... Kochi 2015-04-30
Suresh Thanks Amma for your prayers Bangalore 2015-04-30
prince mathave nagalude company nalla pole pokaname arunapuram 2015-04-30
prince thanks matha arunapuram 2015-04-30
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.bless velakini journey amma give them good health.give me government job amma.thankyou amma.bless rishika for good health. varahapatnam 2015-04-30
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-30
Jason Amma thank you for everything that you have prayed for us. Please pray for Shaan's health. He has constant cold which is creating a big storm at home. If there has to peace at home his health has to be fine. Please pray for his well being and our peace. Please cure him of his cold in these two days. Give Ishu good thoughts. Take of vengeful thoughts from her mind. Bless her and pray for her. Make her understand that a lot of things she does is not good for everyone in the long run. Pray for all at home. Thank You amma Coonoor 2015-04-30
V.christina Dear amma i request my to my husband rechard, please change he bad behavior to came good person, he leave me go 1 year ready, dear amma change him and come back with me & with my daughter please forgive my husband sin,please bless my family amma, Amen. malaysia 2015-04-30
AMOLORPAVAMARY MOTHER HEAL MY MOTHER FROM BLADDER STONE AND HEART DISEASE.SHOW YOUR MIRACLE POWER AMMA. MALAYSIA 2015-04-30
AMOLORPAVAMARY MOTHER HEAL MY MOTHER FROM BLADDER STONE AND HEART DISEASE.SHOW YOUR MIRACLE POWER AMMA. MALAYSIA 2015-04-30
AMOLORPAVAMARY MOTHER HEAL MY MOTHER FROM BLADDER STONE AND HEART DISEASE.SHOW YOUR MIRACLE POWER AMMA. MALAYSIA 2015-04-30
AMOLORPAVAMARY MOTHER HEAL MY MOTHER FROM BLADDER STONE AND HEART DISEASE.SHOW YOUR MIRACLE POWER AMMA. IPOH 2015-04-30
AMOLORPAVAMARY MOTHER HEAL MY MOTHER FROM BLADDER STONE AND HEART DISEASE.SHOW YOUR MIRACLE POWER AMMA. IPOH 2015-04-30
ak Mother niku talsu na badha nanu antaga kshoba padutunanano kani ani a jesus ki vadiladi happy ga unanu i am showing faith on u jesus really i cant able to say now but how many days like pls gve me a job pls i have an opputunity to get a job but i cant and cmg to life partner i just want to meet him in velankanni dats it he only right person to me i know very well u defnitly gve me right person caring,loving person more than my parents,well wishers pls jesus iam getting cry but i cant do anything crying ,praying dis two only d my ways.. h 2015-04-30
2015-04-30
ak U r d only way to me jesus ,mother pls pray to jesus avay davuda pls mother pls pray to avay davuda in d name of jesus.......Amen h 2015-04-30
Diane K C S Dear Our Lady of Velankanni, I do beg of you. Please pray for me. May the good Lord grant Cherry and me our individual job placements and acclimation in Ruidoso, New Mexico starting this school year of 2015. May this blessing extends beyond 2015 so in return we can be blessings to others. I know that it takes a lot of resources to finance our job placements in USA, but with your help dear Mother, we are confident that God will show us the way on how to obtain money/resources needed for our journey. Thank you very much dear Mother! Philippines 2015-04-30
Diane K C S Dear Our Lady of Velankanni, I do beg of you. Please pray for me. May the good Lord grant Cherry and me our individual job placements and acclimation in Ruidoso, New Mexico starting this school year of 2015. May this blessing extends beyond 2015 so in return we can be blessings to others. I know that it takes a lot of resources to finance our job placements in USA, but with your help dear Mother, we are confident that God will show us the way on how to obtain money/resources needed for our journey. Thank you very much dear Mother! Philippines 2015-04-30
Diane K C S Dear Our Lady of Velankanni, I do beg of you. Please pray for me. May the good Lord grant Cherry and me our individual job placements and acclimation in Ruidoso, New Mexico starting this school year of 2015. May this blessing extends beyond 2015 so in return we can be blessings to others. I know that it takes a lot of resources to finance our job placements in USA, but with your help dear Mother, we are confident that God will show us the way on how to obtain money/resources needed for our journey. Thank you very much dear Mother! Philippines 2015-04-30
Soly Dear brothers and sisters in Christ Please pray that God would bless and unite my unbelieving family in God's love and bless my son, Richie, by drawing him to His holy love and call him to a priestly vocation through the intercession of Vailankanni Marymathave Thanks so much and May God Bless you all out of India 2015-04-30
romsha please give a second life to a dear friend of mine. he's so close to me..iv heard he had dis car accident and being comatosed for so many days already. mother of vailankani, pls do help of him, this person is very kind, he helps other people, he is still needed by many. may your miraculous power landed towards him.. korea 2015-04-30
romsha please give a second life to a dear friend of mine. he's so close to me..iv heard he had dis car accident and being comatosed for so many days already. mother of vailankani, pls do help of him, this person is very kind, he helps other people, he is still needed by many. may your miraculous power landed towards him.. korea 2015-04-30
raj kumar.s i belive only in Christ thank you very much pallikkunnu,peermade 2015-04-30
2015-04-30
Raj kumar.s Psalm 99:3 Let them praise Your great and awesome Name-He is holy. Pallikkunnu,Peermade 2015-04-30
2015-04-30
2015-04-30
G V DEAR MOTHER OF MIRACLES AND GOOD HEALTH WE ALL FAMILY THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH MOTHER PLEASE FORGIVE ALL MY SINS AND BLESS AND HELP ME IN ALL MY NEEDS AND WORKS AND HELP ME TO COME OUT OF ALL MY PROBLEMS AND ME ME TO WALK IN YOUR WAYS MOTHER BLESS ALL OUR FAMILY AND KEEP ALL OF US IN GOOD HEALTH AND PROTECT US FROM ALL EVIL SPIRITS AND BE WITH US ALWAYS MOTHER PLEASE HEAL MY FRIEND DURGA PRASAD FROM ALL HIS SICKNESS AND PROTECT HIS FAMILY MOTHER HEAL EVERY SICKNESS OF US AND PLEASE HELP ME IN BUYING THE HOUSE AT ANY COST BY DOING A MIRACLE IN JESUS NAME I PRAY AMEN Hyd 2015-04-30
C R Babu Amma Velankanni Mada I beg plead and pray to God to seek merciful blessings in getting Schengen visa for our daughter to go to France to meet her husband. God please have mercy on us and please answer our humble prayers and bless our daughter with visa Kochi 2015-04-30
devotee Ammme, ente manasile vedhanakal elllam matti tharane ,enik samadhanam tharanne... pta 2015-04-30
devotee Ammme, ente manasile vedhanakal elllam matti tharane ,enik samadhanam tharanne... pta 2015-04-30
A Dear amma aennikariyilla sahacharyavachal aennikoru samathanavumilla ammae achachen aentae jivithathil varannae aennae onnu manasilakki adhaeham aethraeyum vaegam Entae adukkal varanbae amnae prarthikkunnu D 2015-04-30
Daughter Dearest Mother plead to You for your Son Jesus divine intervension to touch and heal me of the head tightness, tyroid, May it leave me forever never to come back. In Jesus most precious and Holy Name I Pray and ask. Amen malaysia 2015-04-29
2015-04-29
r dear mother I beg you help cl at his workplace satan has started creating trouble let there be problems I beg you mother help us let the timings not change of cl let it be the same as he is taking care of kids at home also my timing is not changing open some door mother all seems to be closed no one can help only you and your precious blood we soak roger and kevin too help them understand our problem and not change the timing what to do jesus mother don't let me down I trust in you already he has lost one job after 16yrs now where can we look for another if there is any problem help us also for rashmi road shipment we're in deep trouble for this charges are going high and the cnee is not agreeing to settle help mother also for the kids for their vision and for me to loose weight help cl to get a job in kaz shar naser or some place where there is better timings facilty and insurance too as he is paying too charges outside. m 2015-04-29
Bhavna O Mother of good health, virgin marry,thank you for all the blessings please maa I beg you to listen my poor prayer. Please ma tie me and Anand in holy matrimony with our parents consent. Please ma.. And please bless my friend nikita and her family, they are having a tough time. And mother please heal my mum.I would be always grateful to you. Please show mercy on me mother. Amen Bilaspur 2015-04-29
RANJAN DAS Dear Mother, Please bless my younger brother SANJAY DAS with government job, as he had clear written test & today he has also face the personal interview. Mother i have only faith on you & jesus. So please bless my brother. Thanks for all happiness you have provided to us... AMEN... NAGPUR 2015-04-29
stephen c Dear People Of God, I thank very much Jesus, Mother Mai and you people of God for all the petitions prayers and grace received during this week . Also pray i may have a safe and successful journey from tomorrow. with no interference. Thank you Jesus praise you Jesus love you Jesus. Stephen a servant of Jesus. Mumbai 2015-04-29
Sheeba Amma,We are so sad because of that land problem.The president is against to my parents.He is not allowing to build the compound wall.When this problem will solve Amma?How this problem will solve?Who will help my parents.The government officers knows my father is right but they are afraid that president.So they are not coming to measure the plot and they are not telling the truth.My parents and my sister are facing more problem because of this land problem.Please Amma we are beliveing you.Amma you can do everything.Please Amma come with you son and tell to your son to solve this problem very quickly.We want peaceful mind with out fighting and we want my father's plot with your blessings.Please Ammaaa........ Kuwait 2015-04-29
Alsa Iam alsa shaji from bahrin si ce 4month aftercmy delivery iam suffering with too much health problem kindley pray for me .my left side full pain tiedheadche sinus problem bahrin 2015-04-29
Anon Blessed Mother Mary, ever virgin, I beg Your mercy and forgiveness for all my tribulations. Please intercede to Jesus, Your Son and set me and my loved ones free. Praise You Jesus, Thank You Jesus. Amen --- 2015-04-29
daughter Thank you mother....please pray for us and bless us klj 2015-04-29
Ansu Mary Mother of Velankanni. Plz pray for me health. 2years i hveng the stomach pain.al medicines i followed but no affecting. Amma plz pray for me.... TVM 2015-04-29
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help mum to breathe well on her own, walk and eat again. Lord have mercy on us all, Amen. Malaysia 2015-04-29
ESTHER Dear Amma, Amma nanu 60000/- savira doodu kaledukondini thai dayamadi nanage doodu sigo hage madu tahi. Amma please help madu tahi. Amma nina kalige bilutene tahi. Please help madu tahi. HUBLI 2015-04-29
MALLIKA RANI AMMA PLEASE PROTECT ME FROM THE WICKED PEOPLE FROM MY WORKING PLACE PLEASE RELIEVE ME FROM THE ENEMIES OF MY WORINK PLACE AND GIVE ME PEACE AND HELP ME TO OVERCOME THE ENQURIES OF MY DEPARTMENT PLEASE RELIEVE ME FROM THAT WICKED MAN YOU KNOW AMMA IN MY WORKING PLACE ERANIEL 2015-04-29
r dear mother I beg you help cl to get his job back at kgl or in the head office as he has worked for 16 yrs and has a good reputation help me mother open some door wthout a job we cannot live and move about help us mother jesus I soak this rquest in yr precious blood nothng is impossible unto thee lord m 2015-04-29
rajadurai I want to score more than 1000. puducherry 2015-04-29
MANJU Ente mathave Enikku valyakadangal illthe 5 cent property and home medikkuvsn sahayikkaname. Kdangal veettuvn angraham thsrnamennu apekshikkunnu THOKKUPRA 2015-04-29
Sandeep Holly Mother Mary Help my father and mother in getting recovered very soon from the illnesses. Bless them Thanks Chennai 2015-04-29
M.Rajendran ELLAME NEE THAN THARAVENDUM ETHUVANALUM ATHAI NAAN ETRUKOLVEN THAYE SHOSTHIREM chennai 2015-04-29
infant Judith Punitha Ave Maria..i am with Twin pregnancy..I am having one girl baby already...kindly give me one male baby....plz...kindly give your blessings... nagercoil 2015-04-29
Bennetta Joseph O mother thank you for all the graces showered on us. Mom help us in our problems. Help my child, my husband and all my family members. Keep my child under your care. I ask you to keep her and my husband safe and in good health. Mumbai 2015-04-29
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-29
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help my mum to walk and breathe on her own again. Lord have mercy on us all, Amen. Malaysia 2015-04-29
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy and healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. mother please bless us sort our family dispute. Mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my family peace n happiness. Mother please bless my mom good health. mumbai 2015-04-29
Michael Ma, Good Morning and thanks for all your blessings and graces. Ma, please hear my humble and urgent prayers and have mercy and save me from current situation. Bless my Daughter, mom, husband, niece, sister, my land and jobs. bless my daughter and strengthen her with holy spirit, she should study and retain all that she studied and excel in all her papers and be the topper for the effort taken by her. give good strength of mind and body. Thanks Ma. auh 2015-04-29
vinu thomas amme mathave njangalku vendi puthran thampuranodu mathyastham vahikkunnathinu njangal angaye stuthikunnu. Amme njangal anubhavikkunna kashatathakalil ninnum durithangalil ninnum sambathika budhimuttukalil ninnum njangale rakshikaname ennu apekshikkunnu. njangale ithratholem nadathiyathinayi njangal kripayode orkunnu mathave. KOCHI 2015-04-29
veena vasanthkumar Please pray for my son and daughters marriage settlement . Bangalore 2015-04-29
veenavasanthkumar Velangani mathee please settle my sons and daughter marriage as ur wish and help me in this matter. Bangalore karnataka 2015-04-29
H.Rojes amma thayea please pray for vijiliya physical Problem we are hopefully belive you only ma please stay with us ma show your mersius miracle please ma please tirunelveli 2015-04-29
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-29
n please amma intercede for me and pray that shobu and i get married and his parents readily agree and please i clear moh/dha in my first attempt and secure a good job there and he loves me more than anything in this world karntaka 2015-04-29
n please unite me and shobu in marriage and his parents readily agree and please amma moh/dha i get in my first attempt please amma intercede for me karntaka 2015-04-29
n please amma unite me and shobu in marriage amma please karntaka 2015-04-29
Sheeba Amma Please help my parents to measure that plot and build the compound wall.But president and village people are against to my parents. Please Amma solve this problem quickly with out fighting case police etc.. Amma ........... Kuwait 2015-04-29
Jacob Akhil Francis Mother Mary I attend the 10 th cbsc Board exam I need 98% for all subjects and I need a better IIT coaching also pls pray for me. alappuzha 2015-04-28
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-28
marshal mother mary please help me my birth certificate process is still late more than two months i am waiting for that please help me india 2015-04-28
n please shobu and i get married please and his parents readily agree please and moh/dha i clear in my first attempt and secure a good job there karntaka 2015-04-28
2015-04-28
Ashwini Rajan Mama Mary We Thank U for all the mighty blessings U have given us. As I have been suffering from Polycystic ovaries I am unable to conceive. After many prayers and treatment I am feeling to be pregnant now but it is not confirmed still. I beg U Mama to give me a good result soon. Mother Of Pepetual Help Have Mercy On me and answer my Prayer. Bangalore 2015-04-28
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help my mum to breathe well on her own, eat and walk again. Lord have mercy on us all, Amen. Malaysia 2015-04-28
daughter Mother please pray for me, help me to get recognition, please pray that my surrounding improves, we get a good house and my children are blessed by the Lord asd 2015-04-28
Jeevan Serrao Dear Mother Mary. Thanks a lot for Jaden receiving Jesus for the 1st time. Thanks for blessing him and guiding us through out the preparation.Thanks for Blessing the food and all thorugh the function . Heal my mothers shoulder so that no surgery is required Mumbai 2015-04-28
vinu thomas Amme mathave njangalude melulla ninte kripaykai njangal nanni parayunnu mathave. Njangal eppol anubhavikkunna kashtapadukalil ninnum njerukangalil ninum durithangalil ninnum njangale sahayikaname ennu apekshikkunnu mathave. Njangalku ninte kripa kadaksham undakaname. KOCHI 2015-04-28
n please amma intercede for me please shobu gets married to me and hi sparents agree please i get moh/dha in my first attempt and secure a good job there please karntaka 2015-04-28
V.christina Dear mother please pray for family,my husband rechard leave me go 1 year ready,i pray u please change my husband rechard bad behavior to come good person and come back with me & wit my daughter,amma please forgive his sin,please change him amma,please pray for me amma,thks amma listing my prayer. Amen. malaysia 2015-04-28
r dear mother I beg you pls help cl at his work place let him get a better salary and weekend for holiday he is suffering so much help him to change open some door with better facility I beg you lord also help gulf supply to be cleared without any problems. help cla to be a good boy help him to mix with children and play with boys help him to act like a boy make him strong in yr love and mercy let him not be afraid to play make him rough and tough like other children and not to be timid take care of his stammering stuttering nature I beg you for nothing is impossible my father unto thee help my cas make her a good girl good in studies obident and not to back answer but be understanding and loving to all help us to make a trip to visit you mother to Italy help th to take us for a holiday to her house in swiss so its easy and closer to visit you help me to loose weight help us for our finances needs open some door mother. m 2015-04-28
Nilam Kumari Lakra Thanks a load Ma for your great blessing on Silwanti kandulna for her successfully operation. Thank you soo much ma. please help her for quick healing.love you mother Mary.... Ranchi 2015-04-28
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma thank you very much I got my medical fitness ma.Ma two day my place net was not working so delay say my thanks to you ma.Ma today I am leaving for vacation bless me ma during my vacation when we travel by our two wheeler and four wheeler, bless me and my family ma during vacation protect us from all danger and evils spirit. Once again thank you ma show your miracle on my medical report and got fitness thank you ma... AUH 2015-04-28
ALPHY ENTE AMME NALE ENTE ALANKUTTANTE RESULT ANNU AVANU ELLATHINUM FULL MARK UNDAKANE, PINNE ENTE MILANKUTTANU RANDAMATHU ORU EXAM EDUKAYANU AMME AVANUM NANNAYI EZUTHI PASS AKANE, AVANUM NALLA MARK UNDAKANE, AMME NINNIL NJAN ENTE MAKALE SAMARPICHU PRAY CHEYUNNU, AMME AVARKU VENDA ELLA SAHAYAVUM NEE KODUKANE,ENTE MILAN KUTTANTE KAI PIDICHU AMME NEE AVANE EZUTHIKANE, AMME NINAKU ORAYIRAM NANNI PARAYUNNU. mumbai 2015-04-28
Shamini Madhavae.. umadhu karunaiyal vangina land and house'ku ippo romba problem panranga.. madavae neerthan munadi nintu inda problem'la viduthalai tharanum... Madavae engaluku yarum illa.. engala kaaptum amma... Azeeravathiyum amma... Amen Bangalore 2015-04-28
your disciple Mother, I am very disturbed. Please fulfill on my relationship with KV Hyderabad 2015-04-28
mrudula Holy mother..my father is suffering fron witchcrafts since 8 months and gis health is totally spoiled. He is suffering from severe body pain,and indigestion problem and gastric irritation...please pray that we should get transfer from this place to hyderabad to be far from the lady who did black magic. . mahboobnagar 2015-04-28
THERESA MARION Peace be with you.My name is Theresa Marion. I am 27 years old. I would like to request prayer for my marriage life. I received a few marriage proposals but nothing worked out. Please pray for me to get a good proposal from a good family who suits me and my family. I have health problem (Juvenile Myoclonic Epilepsy). Please pray for my health problem as well. I am always worried that no one will accept me because of my health problem. I always have this fear whenever I receive any marriage proposal. I only trust on Velankanni amma and Jesus. Please pray for me to them. I know my parents are worried thinking about my marriage. Please ask amma to show me my future husband soon. Amen MALAYSIA 2015-04-28
ZURIKA tomorrow is my mother janet coutinho's brain mri. please pray for her reports to be good. AMEN THANE 2015-04-28
mrudula Holy mother. .my marriage is not settling at all..yesterday there is a settlement of 1 Matching we went there but those people are not responding to us.us.not lifting our calls..behaving as their wish..please change their attitude amma and should cal us and respond to us in very polite manner.. mahboobnagar 2015-04-28
Thevaapriyaa Amma three weeks ago I saw pigeon near my flat maa. Amma the bird cannot fly maa. Amma the bird can walk well ma but sometimes the bird walk in circle maa. Amma then I saw the bird behind my house maa. Amma since that day the bird stay behind my house maa. Amma everyday my mother will give bread for the bird maa. Amma look at the bird is so pity maa. The bird can't fly like other bird maa. Even now the condition look worst maa. Amma the bird look very thin maa, not like other birds maa. Amma every time I open the window, the bird will sit there and watch other bird flying and playing maa. Amma it's really pity and hard to see that maa. Amma my mother tried to catch the bird and put in the cage but it not work maa. If we try to catch and then the bird will try to fly and hit at the wall maa. Amma I try to find the symptoms on the internet maa and I got to know that the bird have Paramyxovirus (PMV) sick maa. Amma i really don't know what to do for that sick maa. Amma I really don't know how to take care the bird maa. Amma past two days my place got heavy rain maa. Amma the bird can't find place to hide maa because of that the bird wet fully and stay in the cold maa. Amma please protect the bird to stay warm and safely maa. Amma please bless the bird to fly in the sky like other birds maa. Amma please show your miracle to cure the bird maa. Amma I'm really helpless maa. I really don't know how to safe the bird maa. Amma please take care of the bird maa. Amma please bless the bird to get well very soon maa. Amma please bless the bird to fly like other bird maa. Amma please bless the bird to play like other birds maa. Amma please bless the pigeon to get well soon maa. AMEN... Malaysia 2015-04-28
infant Judith Punitha i Mathavae enaku arul puriyum....en vaitil twins ullanar..enaku erkanavae oru Penn kulanthai ulladu...enaku oru male baby yai tharum...ennai kai vidatheyum...engage amma vku sugamalitharulum.. nagercoil 2015-04-28
Nayana anson MATHAVE I am nayana,studying in class12.my exam starts on may 10 .please pray for me.please pray for me to grow in the love of GOD.please pray for my father anson to get a permanent job in SAIPEM company Saudi Arabia. Saudi arabia 2015-04-28
Nayana anson MATHAVE I am nayana,studying in class12.my exam starts on may 10 .please pray for me.please pray for me to grow in the love of GOD.please pray for my father anson to get a permanent job in SAIPEM company Saudi Arabia. Saudi arabia 2015-04-28
M.Rajendran ellam un kaladiyil vaithvitten nee enna seithalum sari thaye shosthirem chennai 2015-04-28
Juanita dias Dear Mama Mary Pls pray for my family a good health.Mama my elder son did a very big mistake in his life.Now he regret for what he has done in his life.Pls mama intercede to yr son Jesus,pls forgive all his sins.Help him admission in good college,where he will feel no embarrassment. Of his age(24) he should get his result should get good friends.He wants to study back,Mama n jesus.Pls help him, guide him in right path.Also he ipray that he should get his hair again. mumbai 2015-04-28
Juanita dias Dear Mama Mary Pls pray for my family a good health.Mama my elder son did a very big mistake in his life.Now he regret for what he has done in his life.Pls mama intercede to yr son Jesus,pls forgive all his sins.Help him admission in good college,where he will feel no embarrassment. Of his age(24) he should get his result should get good friends.He wants to study back,Mama n jesus.Pls help him, guide him in right path.Also he ipray that he should get his hair again. mumbai 2015-04-28
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless my village for good development.thankyou amma. varahapatnam 2015-04-28
jojibabu amma amma amma i beg t u amma ur loved foots amma in the name of jesusu christ i beg t u amma today my birth day amma please bless and heal amma i want ur protection mercy amma kapadina talli amma raboye rojulal lo kuda toduga vundu talli all probulemns i submit i n the name of jesus christ amma who are celebrate birthday amma death ,maarige amma i submit all amma especuially chanipoina na na mamayaya atma santhi kosem prayer chestuunnau amma in the name of jesus i beg t u amma i submit job wife childrens parents ,all god bleesing in my lise amma beg beg beg beg beg beg beg give good health amma nee seva chese bagyem naku prasadinchu amma amma amen. hyderabad 2015-04-28
vinu thomas amme mathave njangalku nee thanna anugrahathinai stothram cheyyunnu. njangalude njerukangalilum sambathika budhimuttukalilum njangalude koode ninnu njangale sahayikkunathinum ayittu njangal stuthikunnu. njangal eppol anubhavikkunna kashtapadukalil ninnum thurithangalil ninnun njangale veendedukkanamennu njangal vinnethamai apekshikkunnu.njangalku vendi angayude puthran thampuranodu sada neravum madhyasthsm kettarulaname.. KOCHI 2015-04-28
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good heatlth,good wealth, and peace of mind and please protect me and my family from all evils,dangers,accidents and please forgive our sins and forgive those who sin against us. My savior today there will be lots of problems,issues and humiliations and insults from my Boss/my MD and other team members,yes I have committed a mistake by not handling this situation properly,please give me last chance to survive in this company ,my savior I need your blessings and protection to save my job,please give one chance to survive ,my savior I don't want will happen am going to my Boss and asking her for the leave and telling her this problem.My savior please show me way for sorting this issue out ,my MD and these people will not spare me ,please come to my aid and forgive my sins and forgive me for making this mistake. My savior I need you ,without your blessing I can't over come this problems. My savior I need your protecting and please protect me from getting insulted and humiliated, please come to me and save my job and please I beg am really depressed mother Mary am scared hope this should not become big problems for my appraisal and career, you know my commitments and money problems, please help me over come all this and please save me and from all problems issues and I beg you please don't let me down I need you and please forgive me and save me from this mess ,my savior I beg you ,for me this a last option I have in my life ,if this goes wrong then my family will be on road and my career will come to an halt. Please forgive me and give me strength and confidence to over come all my problems and issues am facing,my savior please I need to complete this work at any cost ,please answer my prayers ,I still have problem sin internet ,telephones and cameras, pending is the TV channels and please my savior I need your support and help to over come all this problems and please save my job and please bless my daughter's holy communion so that everything goes well my father will be in Delhi for 2 days bless that everything goes well and my father is happy ,he has done so much for me and my family. Mother Mary for all this I need money and for money I need a job ,please bless my relationship with my MD /my /and all my team members. Please bless all my infrastructure because if all these things work properly then only I can stay in this company. Please give me strength and confidence when am writing my mails and meeting and prestations. Mother Mary if everything goes well without any further issues as committed I'll offer 2001 for your shrine and my savior all my offerings which are pending will be fulfilled when ever I come to your shrine. Please show me way for my survival, mother Mary I need to stay in this company till I get good job, my savior why is that am not able to get job anywhere and am not getting any clues or leads so that I can and approach. Please come to me and protect me and save me form all issues problems ,and please be with me in all my meeting and communications and bless my relationship with my team. Pls bless this day and my journey to be save and help me over come all my problems and guide me take right descions and issues. In your name am going to that villa to complete the pending work so that I can go peacefully to Delhi. Please be with me and protect me in all my problems issues and other problems,Pls agin forgive me for my problems issues. In your name am starting my day pls be with me. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threating danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2015-04-28
sushmitha Dear mother mary i need your blessings over my desert life.i and my husband have no good relationship at all.he avoids me for no reason and he have no love on me he will not care for me even when im in a severe pain or sick.you can alone change my life mamma.he is not talking with me. im so jelous that he speakes very normal to others in his family and expect me.talk to your son and bless my life oh mother mary. And im 5 month pregnant now he will not care even if i cry on pain but he just looks at his mobile and watch something..to him every other thismgs are important than me. i got married 2 years back and 1 and half year he was in abroad.but still no love on me.is that because im not so much beautifull.but being not beautiful is not my mistake it is gife of god to me. And mamma i have only 6gm of hb in blood.that is i lack blood being pregnant you that im in a danger level.your son died for my sin and shed his blood for my sake. shower me with that blood and make me health ma mary.AVE MARIA .PRAISE THE LORD...PRAY FOR ME ,MY BABY AND MY FAMILY AND THE WORLD. AMEN chennai 2015-04-28
Caroline D Mother Mary , Most pure and chaste: Mother of Jesus : Pray for me to find a suitable life partner who can love and take care of me throughout my life . Amen Mumbai 2015-04-28
Kavitha Henry Mother amma pls have mercy on me amma pls that I want money to solve all my problems amma I am not getting too much of business amma iam very much worried that what will happen to me amma pls help me and solve all my problem soon amma having lot of money problem amma soon I should get one good job amma without any certificate amma pls help me and arrange me the money amma pls pls bless me amma I should not have any problem amma don't lend me down in front of any one amma pls help me and solve all the problems amma pls pls be with me amma with your grace I should get one good job amma always be with me and help me amma don't leave my hand for any thing amma always be with me amma ,,,my husband came home and is walking alone amma iam very much thanking you that you have been with him amma don't leave is hand amma always be with him amma pls pls help me amma always bless my family and my 2 children's amma Amen. Bangalore 2015-04-28
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child> mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion good full time maid. mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless my mom of good health, Mother please bless my family peace n happiness. mumbai 2015-04-28
n please amma intercede for me please amma shobu and i get married please and he loves me more than anything and his parents agree for marriage soon and i clear moh/dha in my first attempt and secure a good job and today pavani presentation goes well karntaka 2015-04-28
Your Devotee Mother Mary, My Employer has to give me company insurance, he is taking time to get me one, please get me the insurance as early as possible, day by day iam facing new problems , please remove all the problems from my life and secure my future Regards Devotee USA 2015-04-27
jojibabu amma amma amma amma amma amma amma i beg t u amma ur oritection blessings amma nenu ippativaraku batiki vunnau ante amma ur wish amma in the name of jesus christ only its happen amma i submit nepal people some are died amma some are in hospital they dont know their position amma please heal and touch and recovery amma entire country amma and people amma who or lost entire thinsg amma in the name of jessu christ i beg beg beg beg beg beg t u amma i submit farmes amma they are also lost their crops amma please show ur mercy amma i beg t u give good health amma for me anf my family amma in the name of jesus christ i beg t u amma yesterday my wife birth day amma tomorrow my bitrh day amma i ne the name of jesus christ i beg beg beg beg t u amma i want u protection mercy love amm health amma toduga vundu talli parents childrens amma releatives amma i submit tu amma job lo amma travelling lo amma agipoina ann panulu tirigi punruddarinchu amma ur wish please slove financial probulems amma house vunna intilo inka amma ur wish iete continue cheyyi amma new house nee chittem iete kone bgyem prasadinchu amma teacher surgery i subit ur loved foots amma i beg beg beg beg beg beg beg beg beg beg beg t u a,,a ur wish amma jesus jesus jesus i beg beg beg t u please forgive my sins and family members amma who r in sick health probulem hospital surgery amma i submit ur loved foots amma amen hyderabad 2015-04-27
Nilam Kumari Lakra Dear Ma, Today I am with heavy heart praying for Silwanti Kandula's health recovery, you know she is very poor and illiterate girls had came for her livelihood but unfortunately now she become very serious. I know ma you can do miracle for. with lots of faith and believe I am begging in front of you recover silwanti and make her operation success. With lots of love and hope Your daughter. Ranchi 2015-04-27
Renu Dar Mother Mary , I pray to you to please heal my daughter , Neha dar, who is suffering from acute pain due to herniated spine .please heal her spine . keep your hand of protection on her and all of us . Thank you Mother . Bangalore 2015-04-27
Rosely Ouseph Mother Mary please pray for my son who is suffering from left leg legament tear,Ma please as soon as get it well,please have mercy on him india 2015-04-27
Michael Ma, Good Morning and thanks for all your blessings and protection on me and on my family. Ma, I put my deep faith in you for I know you will do wonders. bless us with want we need and protect us from all evil. Thanks Ma. auh 2015-04-27
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-27
celine sweety bennet Dear amme im in tears. I need a permanent job In st.josephs boys calicut kerala.calicut 2015-04-27
celine sweety bennet Dear amme im in tears. I need a permanent job In st.josephs boys calicut kerala.calicut 2015-04-27
ak Dear mother thank u for u r blessings,kindness on me i wrote exams very well mother pls pray to jesus to get a good job and prayer ful life partner pls mother i want to meet my lifepartner in velankanni pray To jesus .....Amen g 2015-04-27
ak Dear mother thank u for u r blessings,kindness on me i wrote exams very well mother pls pray to jesus to get a good job and prayer ful life partner pls mother i want to meet my lifepartner in velankanni pray To jesus .....Amen g 2015-04-27
Sandeep Holly Mother Mary Bless my child so that she does not cry often and help her in getting proper sleep. Please help her in not crying very often. Please wash away all the devils from her. Thanks Chennai 2015-04-27
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted> Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion good full time maid. Mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless family peace n happiness. Mother please bless avi n me good health n job satisfaction. Mother please bless my mom good health. mumbai 2015-04-27
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless meeting today in panchayath.bless my pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-27
r dear mother I beg you help cl at his job place again problem has taken place for timings satan is getting powerful jesus I soak this request of mine with yr precious blood where to go now help cl to get an opening at his head office. mother help ke and him at the meeting for the timings open door lord all seems to be closed we're in deep trouble don't let us down let everything be normal and nothing to be changed jesus mother don't let me down you're always our support we need you or help him to get a job in kaz without a job its difficult we have to go back with no house to stay no school for kids no facility no money help us mother I beg thee I trust in you for you'll be at our side. m 2015-04-27
Sandeep Holly Mother Mary Help Suresh in getting this new job without any problem and help him in his difficult position Thanks Chennai 2015-04-27
K JAGADEESH Dear Sir, Please pray for solve of my all problems, i don't have peace in my life , so please pray for peace in my family. am struggled with financial problems, so please pray to solve of my financial problems, i have two sons , please pray for them to grow with Good nature. Guntur 2015-04-27
js AMMA, I BEG YOUR POWERFUL INTERCESSION TO CHANGE THE MIND SET OF MY IN-LAWS. PLEASE GIVE THEM A FEELING THAT ME AND MY FAMILY WILL STAY WITH THEM. PLEASE SHOWER YOUR MERCY ON THEM TO HAVE A WILLIGNESS TO SELL THE PROPERTY AND BUILD A NEW HOUSE. PLEASE MAKE MY MOTHER IN-LAW LOVING NATURE AND MAKE HER TO UNDERSTND THE VALUE ME. PLEASE BLESS US TO AVOID UNNECESSARY INVOLVEMENT OF SISTER-IN-LAWS IN THE FAMILY. jomolesinoj@yahoo.com 2015-04-27
selvi Amma,Please help my husband to complete his M Tech project work and get his degree successfully.He is suffering a lot,help him and guide him amma towards success,this is his last chance,we firmly believe you amma,his guide and HOD should accept his work.Show mercy on him Amma,we strongly hold your feet. Chennai 2015-04-27
selvi Amma,Please help my husband to complete his M Tech project work and get his degree successfully.He is suffering a lot,help him and guide him amma towards success,this is his last chance,we firmly believe you amma,his guide and HOD should accept his work.Show mercy on him Amma,we strongly hold your feet. Chennai 2015-04-27
j Amma, I beg your powerful intercession to heal my lump and recover the clubfoot of my son. Please shower your mercy on us. i beg your miracle to happen.I promise i will come to your shrine with my family. Please bless us to settle in our hometown and bless us with a own house in our native place.Kindly shower your mercy us to have source to buy the home. D 2015-04-26
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help her to breathe on her own, eat and walk again. Lord have mercy on us all,Amen. Malaysia 2015-04-26
2015-04-26
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-26
Maitheli Ashok Alhat Dear mother marry my Elder sister is suffering from kidney infection as the dylasis is going on, amma please cure my sister kidney and let the dylasis stop forever as her age is 35 and she want to get marry as whole life is there so please cure her kidney and pain she is suffering right now also do not let go for trans plant .amma cure my sis lonavla 2015-04-26
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen -- 2015-04-26
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me govenment job amma.thankyou amma. varahapatnam 2015-04-26
r dear mother I beg you to help all natural disasters spl the earthquakes in the world. take care of the world we beg you for forgiveness and peace in the world. help cl at his work place for an increase in salary as he is paying money from his pocket low salary no saving only expenses how will this work mother I beg you help us.help reu to change his job with better facility as he has a very low salary open some door for him mother help all jobless and take care of the youth draw them closer unto thee help my kids draw them closer mother change their hearts make them humble and kind to be helping nature. help this place not to add more expenses to us help the people coming to be sharing to be kind and not fighters but loving to blend with us well. help us in our saving too.help to increase our salary and to get dental facility for me as I have too much problem with my tooth I beg you lord and mother for a miracle. help the children in their studies help us in our finances too help geo to give our money back to us we need finance help from you lord open some door for us. m 2015-04-26
Jaya balihar Dear mother Mary thank u for all that u have given us.I request u to heal my brother in law satyajit john balihar who is suffering from lung cancer. Also ptay for my friends husband to get a job soon.pray for my entire family my daughter divya my husband David my mother Sushila kujur and my whole family. Show mercy upon us. Jamshedpur Jharkhand 2015-04-26
stephen c Dear People of God, I thank very much Jesus and you people of God for all the blessing, grace and petitions received during this week. Thank you Jesus Praise you Jesus Love you Jesus. Stephen a servant of Jesus. Mumbai 2015-04-25
Kavitha Henry Mother mary pls have mercy on me amma that all my problems should solve soon and I should take back all the golds and give it to aunty before she is coming from London amma pls help me and pls be with me amma don't leave my hand always be with me amma every thing good thing should happen to me amma pls help me amma in money thing and always I should be cool and I should not get angry on my childrens amma soon I should get one good shop for my driving school and it should be your blessing shop amma nothing bad should happen to me all good thing to happen to me amma pls help me and be with my family amma may first is my son birthday amma I don't have money to celebrate my sons 1st year birthday amma so pls arrange the money and give it to me amma pls bless me and help me amma you have done me so much of good things to me amma pls help me in my business amma always I need your blessing amma Amen. Bangalore 2015-04-25
r dear mother i beg you to bring back hilda's son who is lost from 3-4 days jesus we intercede with you pls we soak this n lord in yr precioius blood mother nothing is impossible unto thee i beg you help let all problems be solved help also for us to say the rosary daily help us to get their vision back our eye sight to be normal i beg you lord also for peace and for the youth to draw closer alos for mahim church not be demolised. help me to loose weight help cl to change his job bless him with a better job with better facility and salary as this job has very low salary and he has a lot expenses to bear from his end help them to increase their salary as its very verylow we as a fly cannot surive on this open door dear motehr i beg you, bless my teeth take aways my dental sickness heal my gums and teeth lord i soak them in yr preciousblood. mother i thank you for the countless blessings of granting my prayer request for jer shipment to be delivered on time this miracle was possible only because of you and nothing else help us mother and jesus to make people know of yr love and yr grace and mercy . help all the children receiving communion . help my daughter to eat well and make her healthy also tall mother help my kids not to fight and back answer grow them in your love and yr care make them yr children and take care of us all the days of our life thank you for the countless blessings showered on us be with all time. help all who have rquested for prayers grant them their petition help me to loose weight and not eat any junk food m 2015-04-25
2015-04-25
Jaya balihar Dear Mother Mary I request u to heal my brother in law satyajit john balihar.sshow mercy upon him.please pray for my mother sushila kujur good health. Also pray for my friend s husband Mr Rajiv verma that he might get a job soon. Jamshedpur 2015-04-25
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help her to breathe on her own, eat and walk again. Lord have mercy on us all, Amen. Malaysia 2015-04-25
GREESHMA NATH GK amma thayay, my job problems will remove pavara 2015-04-25
GREESHMA NATH GK amma, velankanni mathavey, please remove my job oroblems and my daugher pray for education help for you pavara 2015-04-25
Jagan Ave Maria. I earnestly implore you to bless me to succeed in getting Central Government Job HYDERABAD 2015-04-25
Serena Botelho Please pray for the complete recovery of Mr. Francis Machado,65 years old. He is currently in the ICU at Manipal Hospital-Goa, in a critical condition. He suffered 2 cardiac arrests this morning. Panaji 2015-04-25
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-25
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma today I said my 6th last week novena.Ma praying for my medical result,today company received my medical report slight veration on blood and eye sight,ma tomorrow my company will submit the report to main company, ma praying my main compay should give the fitness certificate to my medical report show the miracle on this report ma.Thank you ma in advance. AUH 2015-04-25
Thevaapriyaa Amma finally my Year 2 degree come to the end maa. Amma next week my exams is start maa. Amma please bless me to do my exams well maa. Amma please bless me to get a good grades maa. Amma next week Monday (27/04/2015) I have Management Accounting exam maa. Amma on Wednesday (06/05/2015) I have Advanced Financial Accounting exam maa. Amma on Monday (11/05/2015) I have Taxation exams maa and lastly on Thursday (14/05/2015) I have Business and Company Law exam maa. Amma please bless me to do these four exams well maa. Amma please bless me to get a good results maa. Amma please bless me and be with me always maa.AMEN... Malaysia 2015-04-25
NATARAJANM AMMA VELANKANNI MATHAVEY KARTHARIN THAYE PRISONIL THUNPAPADUM VANITHAVAI MANNITHU AVALAI RACHITHU 27/04/2015 ANRU BAIL KIDAIKA ARUL PURIVIER KARTHAREY ENTHAYE Erode 2015-04-25
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US". Ma here I submit prayer request for my medical fitness.Ma today morning my company will submit my medical report to main office,the chief medic whoever go through my medic report send the holy spirit on them and issue fitness certificate for my medical report,show your miracle on my medical report ma.Thank you in advance ma. AUH 2015-04-25
Michael Ma, I am upset and tensed, please touch me with your healing and soothing touch. auh 2015-04-25
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth, peace of mind and protect us from all evils, dangers and accidents and please forgive our sins and forgive those who sin against us. My savior thanks for giving me and my family another day and another life. My savior i need beg you to bless this day with peace success,prosperity and protect my job, name and dignity in this company. My savior i need your blessing care and grace to sustain in this company and forgive me my sins and forgive those who sin against us,i just have only 3 days to make all things live in Villa's and one thing which i have not completed is the MATV ,this will have major implication on my career, job and increments and promotions. Please help me control my emotions and anger till i get better job, having problems with my boss my md and any other people please i don't have a job right now ,i need your guidance help to get me better job and save my life and my family, Please bless me so that i don't think bad for others and save me from the evils clustered and protect me ,bless this day and this coming week with peace success and prosperity. Mother Mary am not able to complete my work at the Villas for which i have come ,there are so much of obstacles and problems am facing ,please bless me so that these obstacles go away and i get my work done ,please bless me and give me strength and confidence to work hard and prove rather than thinking and wasting my time on the things which cant be changed. Please my savior my stress level has gone save me from this i need you and your blessings to over come this problems and work hard and prove myself rather than thinking bad about others. My savior please my MD has come please bless my relationship and my Boss's relationship and my relationship with my team mates, my savior i just want to have good relationship with everyone and go out in proper way.my savior please help me work hard and protect me from all evils ,dangers and accidents and forgive me for my sins and save my job ,i beg my savior everyday ,i feel insecure and i want settle in one company fro at least 10years so that my career is shaped .Everyone has stable job and peace in there life but for me its only tension ,irration,vengeance and problems. Please give show me way for my problems, this job is given by you and mother Mary my savior i need you blessing ,please save me form getting humiliated or insulted ,i just have 3 days to handover everything to the operations team. Mother Mary 29th night am leaving to Delhi next Saturday is my daughter's first holy communion ,she is very excited ,please don't don't let her down ,she is very happy to wear her dress, please bless her so that everything goes well. My savior i need your blessing as i have only my father coming for this function,so please bless me and give me strength and confidence to make this function successful.My savior i beg you to save my job and name and dignity in this company. My savior please come to my aid and protect me and bless me control my ego anger otherwise same things will happen to me like it happened KF please its taken so many years to recover with your grace i could ,but now i don't want that to repeat again. My savior i beg you i need you to be with me always and with my family and protect us from all problems ,give us happy life and please keep us united. please bless this final project so that it goes well without any problems. I beg please come tome and help me mind my business and work for me and my company ,Save me form my MD my boss and all my team members, I beg and ask to forgive me and forgive those who sin against us as you did for us. In your name am starting this Sunday and the coming week please be with me and protect me and my job and give me strength and confidence to work hard fulfill my MD's requests and be with me in all my meeting ,communication and bless all my mails and communication and others things .IN your name and with your blessing and grace am going ahead to end this prayer. come to me and i trust in my prayers, rosary and your blessings. Mother Mary am not getting any other offer, here my job is not stable and i really feelings in secured. Mother Mary pls bless all my family members ,friends and all my IT infrastructure so that everything goes well without any problems. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.DOminic Vijay Kumar Dehradun 2015-04-25
2015-04-25
Mary .Ammae valarrae sankadothadannu njn ethu parayunnath njn pranannu thulyam snehicha all aennae aenthu kondu snehikkunilla manasillakinilla ammae aethrayum vaegam aennae manasillakki adheham thirichu varum aentae jivithayhil aennu vishvasikkunu ammae aennae ksividallae oro dhivasavum ethu orthu njn dhukikkunnu ammae aennae onnu manasillaki ahaeham aentae adukkal varannae prarthikkanae.. Tvm 2015-04-24
R Mahalakshmi PRAISE THE LORD AMMA PLEASE SAVE ME FINANCIAL PROBLEM PLEASE BLESS ME. Secunderabad 2015-04-24
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatunna ella budhimuttukalum vishmagalum maati saukyam tharaname..athdoppam ente jobokke nallareethiyil munpotttu poyi nalla reethiyil sales acheive cheyuvan matahve edayakanme...ente driving test next week aanalo test okke pass aakuvan mathave anugrahikaname...athodoppam ente pappaudeium anishchanteium bussineesil okke matahave anugrahikaname..athodoppam anishante veedu pani okke nadakuvannalo naala reethiyil pani okke poorthiyakuvan mathave anugrahikaname...athodoppam enneium ente pappa,mummy,anishchan,remiya chechieum ashima moleum thiru munpil samarpikunnu aapathil ninnum anarthgalil ninnum rogathil ninnu viduvichu kaathukolaname..Amen Dubai 2015-04-24
V.christina Amma please pray for my family,my husband rechard come back wit me & with my daughter. amma please change my husband bad behavior be come good person,plase change him amma,my husband leave me go 1 year ready,he doing evil things all,pls chenge him amma and please forgive him amma,thank you amma. malaysia 2015-04-24
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help her to breathe well on her own, eat and walk again. Lord have mercy on us all,Amen. Malaysia 2015-04-24
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.bless my village.give me government job amma.thankyou amma. varahapatnam 2015-04-24
2015-04-24
Natasha Holy mother Velankanni save us, guide us & protect us from dangers & sudden attacks as my entire family is facing difficulties each passing day due to a death blame put on my brother by his own close friends because he is young and not knowing anything about this incident. PLEASE MOTHER I BEG U TO BRING OUT THE TRUTH & GIVE JUSTICE TO HIM. Mary my mother keep me away from mortal sin. UK 2015-04-24
Elaine coelho Mother Mary please transform people at my work.especially my boss..that he may appreciate my work and decide to keep me in the company.Bless my husband's job that he may acheive his sales targets and get confirmed in the company.Solve our financial problems. Bless our daughter Evangelyn and our parents and loved ones.Amen Umm al quwain uae 2015-04-24
Elaine coelho Mother Mary please transform people at my work.especially my boss Mr.Simon that he may appreciate my work and decide to keep me in the company.Bless my husband's job that he may acheive his sales targets and get confirmed in the company.Solve our financial problems. Bless our daughter Evangelyn and our parents and loved ones.Amen Umm al quwain uae 2015-04-24
Elaine coelho Mother Mary please transform people at my work.especially my boss Mr.Simon that he may appreciate my work and decide to keep me in the company.Bless my husband's job that he may acheive his sales targets and get confirmed in the company.Solve our financial problems. Bless our daughter Evangelyn and our parents and loved ones.Amen Umm al quwain uae 2015-04-24
ANOOP ANTONY Ente mathave enikk tata companiyil allengil mahindra,parle g compnyil oru nalla joly nalki anugrahikkaname Thokkupara 2015-04-24
ANOOP ANTONY Ente mathave enikk valiya ru house paniyan sahayikkaname Thokkupara 2015-04-24
Leena Jayraj Mother Mary, I am very much depressed.When I visited you last year I kneeled and prayed with you for manythings.But,nothing is succeeding in my life.Mostly my parents are worried that I still didn’t get married. Why Mary your punishing me please forgive me if I had done something wrong. Please send one nice guy who will understand me and my parents and whom do you think he is the right person to look after me, as you are aware what kind of guy I want in my life., I trust you, please my marriage should get fixed by this year Bangalore 2015-04-24
Swapan sarkar Praise the lord dear Amma please help me from debt crisis.need for financial breakthrough. Tezpur(Assam) 2015-04-24
C R Babu Amma Velankkani Mada I beg plead and pray to God for merciful blessings to my daughter who is seeking Schengen visa to meet her husband in France. Amma I we and pray to God to bless her with the visa without any problems kochi 2015-04-24
mrudula Holy mother, give deliverance to my father suffering from witchcrafts and evil spirits.give him good strength, energy..amma give transfer to Hyderabad amma...no body are helping us... mahboobnagar 2015-04-24
Juanita dias Mama Mary,Pls bless my family a good health.My husband is having back problem,heal him completely from all sickness.Mama Pls pray to baby jesus,my husband n my sons to be blessed with holy spirit. My younger son is in his final year of engineering.(instrumentation),from 14th May to 1st June 2015.to concentrate with deep faith in studies.and write the correct answer of each question paper's n pass will flying colours.. . mumbai 2015-04-24
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house, good increment good promotion good full time maid. Mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please bless my family peace n happiness. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless us sort our family dispute. Mother please bless my mom of good health. mumbai 2015-04-24
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-24
Roche Victor Maria Doss Nandri Madhavee, amen Chennai 2015-04-24
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-24
Sandeep Holly Mother Mary Help me in surviving my TCS journey in Riyadh Saudi and help me in learning and progress me up in my life. Also help me in rest of my life till death. Thanks very Chennai 2015-04-24
n please amma shobbu and i get married and i clear my moh/dha in my first attempt and i secure a good job please karntaka 2015-04-24
Saritha Amma Madhave, please bless me that i should deliver my baby safely without any complications. i should give birth to girl baby with your blessings & call her as Maria first. please amma i beg to give me a girl baby because almost of my family members have ego thought that i should not deliver a girl baby whih you are aware, please bless me that my cravings with you should be fulfilled & my wish for delivering a girl baby should be offered. amma thaye i beg you day & night for a girl baby, please madhave bless me & ensure my wish is granted. amma we believe in you please madhave hear with cries & prayers & grant me my wishes. Bangalore 2015-04-24
V.christina dear mother pls bless kirtha ,now dr suspected she have leukemia ,dear mother u are mother for her,amma,pls hell her from sick ,be come normal child. pla amma pray for us malaysia 2015-04-23
margaret dorothy O maa let my sonography come normal maa. I have faith in u. Help me. jabalpur 2015-04-23
2015-04-23
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please help her to breathe on her own, eat and walk again. Lord have mercy on us all. Amen. Malaysia 2015-04-23
Raja Dear mother Mary my mom met bus accident and now she is in hospital and not getting her memory. Please amma pray for ma mom. Please amma . amma mother Mary vijin 2015-04-23
Jeevan serrao Dear Mother. Please keep my son in Good health as he will be receiving Holy Communion for the 1st time. Guide and protect him through out his life. Bless us all and guide us & our family through out our lives & specially the the function on sat . Bless the food which will be prepared for the function and all other arrangement Heal my mothers should problem and also praying that her shoulder scan report to be Normal. Mumbai 2015-04-23
J. S. Lobo Ma, thank you Ma for praying for my family. For all the healing my brother received. Ma do continue to pray for each one of us, my mother, brother, my sister and her family, for me and my husband, to be touched and blessed by God. Do pray for your son’s precious blood to cover each one of us, so that we are released from all sins and evil bondages. Ma, pray for my sister and her family to be reunited, to make Jesus the center of their lives, to receive the gift and spirt of prayer, forgiveness and to make a good confession and repentance for their sins. Likewise, I ask you to pray for each of my family members to receive the gift and spirt of prayer, forgiveness and to make a good confession and repentance for our sins. Please pray for God to forgive us for all our many sins and transgressions. Bless our homes, our jobs, our salaries. Bless each one of us with good health. Take away all our sickness that is with each of my family members, hypertension, diabetes, acidity, back problems, headaches, mental issues, cholesterol problems, all sickness and diseases that has been planted by the devil away from us. Pray and plead with your Divine Son to pour out his Spirit on us, so we are guided always to walk the paths God wants us to. Ma, pray for me and my husband so that we are able to conceive. Ma, my brother is having many evil spirits and a dark figure that taken hold of him. Please pray and intercede on my brother’s behalf that he is released from these evil spirits soon. Many people are praying and interceding for him but he is not being healed. Also pray that my mother does not leave God and our church and go to do evil things. My brother keeps getting fits. Please pray for him for this too. Thank you Ma. Pune 2015-04-23
M Banu Amma! Thank you for your prayer. I got my uncle son ph number. I explain my situation through SMS way. Please pray for me; He must understand me.He must come back and marry me within few days. He must live with me. he must not marry any other girl. Please remove that fear for my heart. Tuticorin 2015-04-23
M Banu Amma! Thank you for your prayer. I got my uncle son ph number. I explain my situation through SMS way. Please pray for me; He must understand me.He must come back and marry me within few days. He must live with me. he must not marry any other girl. Please remove that fear for my heart. Tuticorin 2015-04-23
M Banu Amma! Thank you for your prayer. I got my uncle son ph number. I explain my situation through SMS way. Please pray for me; He must understand me.He must come back and marry me within few days. He must live with me. he must not marry any other girl. Please remove that fear for my heart. I cannot live without my uncle son. He love him so much. He must realized his betrayed. Tuticorin 2015-04-23
Sangeetha My dear matha amma I have face my lots of problem My husband. My husband hate me. He always scolding me. He hated me and child. He is not sleeping every night. Amma thaya only solution for u. Matha Amma you r with me. Maths Amma please give solutions for my problem. Chandrasekaran 2015-04-23
daughter Mother please pray for me and my husband. Help my children to do well and also give them the blessing and honour to glorify God's name through their sucess and good behaviour. May their talents multiply and help them to gain favour in the eyes of their teachers and friends. sdfg 2015-04-23
mrudula Holy mother,my dad went to Hyd to meet g.m to ask transfer to Hyderabad... Amma please help my father while he is facing general manager in asking transfer to any of zone of Hyd.. My father gets tensed fear while talking to g.m..amma help us..g.m should listen to my dad's words and talk to my father politely and should not torture with his words to my dad...gm harasses if we ask transfer to Hyd amma.so please amma ur presence shall be there and that g.m should talk very politely with my dad.amma let others ( seniors) should also help my dad in forwarding the letter of request transfer and pass information to g.m about my dad in a very good way...amma no politio should be there ...help my father today while he is facing General manager in asking transfer to Hyd...reduce tension to my dad...ammma help us to get transfer to Hyd.thanking you mahboobnagar 2015-04-23
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.bless specially rishika for good health bless my village.give me government job amma.thankyou amma. varahapatnam 2015-04-23
2015-04-23
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-23
V.christina dear Amma,i request my pray from u,please help my family amma,Dear amma my husband rechard leave me go 1 year ready pls change he bad behavior to come good person,& come back wit me & wit my daughter.Please change my husband rechard, Amma please forgive his sin,& bless him, please help me amma ,tq amma listing my prayer, malaysia 2015-04-23
V.christina Dear Amma 2moro i have big project wit customer,pls help me to settle tiz project,pls help me amma malaysia 2015-04-23
B MALLIKARANI AMMA KINDFUL AMMA PLEASE RELIEVE ME FROM THE ENEMIES OF MY WORKING PLACE AND UNNECESSARY ENQURIES REGARDING WORKS BEING A LADY AND JEALOUSY OF MY JOB THEY ARE CREATING PROBLEMS PLEASE AMMA I AM VERY WORRY ABOUT THAT PLEASE PROTECT ME AND GIVE PEACE TO ME TODAY NAGERCOIL 2015-04-23
Sandeep Holly Mother Mary Thank you so much for blessing my brother with baby boy. Thank you so much Chennai 2015-04-23
Bernadine christopher Family peace,repentance, forgiveness. Coimbatore 2015-04-23
Bernadine christopher Family unity, forgiveness, repentance. Coimbatore 2015-04-23
Bernadine christopher Family unity, forgiveness, repentance. Coimbatore 2015-04-23
raj kumar.s dear in Christ thank you very much Pallikkunnu.Peermade 2015-04-23
shaji Ammey mathavey anugrhikaney njagaley.ammey kunju vavyn Kathy kollaney Moley kathu kollaney ammey duty il kathukollaney ellam ammyudey sannyidyil arpikunu.AME. UAE 2015-04-23
jesintha anne thomas Dear Velakanni Amma, I will be sitting for final exam and I hope i will pass everything and finish my degree succesfully with the allocated time give.Please pray for me amma. petaling jaya, malysia 2015-04-23
jesintha anne thomas Dear amma, I love a guy more than more than 3 years. I hope he understand me and come to me.I wish and pray our relationship end in a marriage.Please listen to my prayers and grant us our needs.amen.please hear our prayer. petaling jaya 2015-04-23
marydurai Dear matha, My mother go for cancer operation please help me do success the operation.give me the strength do take care of mummy health because I also pregnant (8 month).pls matha help me Thank you matha tuticorn 2015-04-23
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-23
Mrs Daisy Kindly pray my son Alfred for getting a suitable job in a reputed company in bangalore. Kindly pray for my daughter Anitha for a marriage. Bangalore 2015-04-23
Mrs Daisy Dear Mother Mary pray my son Alfred for getting a suitable job in a reputed company in bangalore. Dear Mother Marypray for my daughter Anitha for a marriage. Bangalore 2015-04-23
Mrs Daisy Dear Mother Mary pray my son Alfred for getting a suitable job in a reputed company in bangalore. Dear Mother Marypray for my daughter Anitha for a marriage. Bangalore 2015-04-23
vinu thomas amme mathave njangalude melula ninte anugrahathinai sthothram cheyyunnu. njangal ippol anubhavikkunna kashtapadulalilum njerukangalilum njangalude koode ninnu predisanthikale tharanam cheyyan shakthiyum vivekavum choriyunnathinumayi njangal niinodu nanni parayunnu mathave. njangalude ee avasthakil ninnu mojenum tharuvanum njangalude njerukkangalum sambathika budhimuttukalum theeranum vendi angayude puthranaya eeshoyodu njangalkuvendi mathyastham vahikkaname ennu apekshikkunnu. KOCHI 2015-04-23
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house, good increment good promotion. Mother please bless my dad of eternal peace, Mother please bless avi n me good health and job satisfaction. Mother please free avi n me of all worries n tension. mother please bless my family peace n happiness. mother please bless my mom good health. mumbai 2015-04-23
Roche Victor Maria Doss Nandri Madhavee, Amen. Chennai 2015-04-23
Sandeep Holly Mother Mary Help my child to get proper sleep Help my wife and her mother to survive the difficult situations in nursing my child Thank you Chennai 2015-04-23
Rosely Ouseph Oh Mother Mary please pray my son he is too much tension in his work place,Ma please pray for him and will get good health and peace of mind.My daughter will also pass the interview and get the new job. india 2015-04-23
na please amma i marry shobu and i clear moh/dha in my first attempt pplease and secure a good job soon and pavani gets a good job other than lecturer please karntaka 2015-04-23
daughter Please continue remembering us before your son , Jesus, mother may the light of God always protect us from all kind of evil things. May my children be worthy to receive the grace and blessings of Christ at all times and help them to reach new heights through His Blessings. Bless us to have a house of my own. Help me to get the financial upgradation asd 2015-04-23
M Dear Maa Velankanni am pregnant and am bleeding, i have been able to fall pregnant after lot of prayers just hope that my baby will be fine and i will not miscarry I have full faith on u mother, I know u will always be with me. I wish to hold a baby same as you holding Jesus God..Plzz help me maa. MRU 2015-04-22
mrudula Holy mother. .give deliverance to my dad from witchcrafts and evil bondages. give him energy as he was suffering from severe body pains ,knee pain,joint pains,head pain..he is so week amma..heal him..also give ua transfer to a new place as early as possible. U help my dad in getting transfer while talking to higher authorities. .protect my father from witchcrafts and black magic. . mahboobnagar 2015-04-22
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will.Please help her to breathe on her own, eat and walk again. Lord have mercy on us all, Amen. Malaysia 2015-04-22
Anusha kanna Dear mother thank u thank u soo much I wrote exam well thank u Jesus tank u so much for all....Amen guntur 2015-04-22
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-22
Vichita Please pray for my brother Sydney so that he pass his medical and get the job. he was jobless form last 5 years. He got one job but due to some circumstances he lost that job. please pray for him that he gets the job. And also pray for me and my boyfriend to get new jobs since, we have lots of loan to repay. I tried in many companies, even went for interviews but nothing is working out. I stay with my cousin. But her in laws are blaming me b’coz am staying in my cousins house. Please pray for us so that I can leave my cousins house. And brother and boyfriend gets lots of success in their career. India 2015-04-22
V.christina Dear mother mary tq so much listing my pray amma, tq amma today u settle my work promlem amma, amma pls settle my work project amma,pls amma malaysia 2015-04-22
V.christina Amma my husband rechard mariselvam pls bless him ,please change he bad behavior to come good person,dear amma please change him & come back with me & with my daughter. please bless us amma,Amma i request my pray to u,pls give my family back..one happy family,i believe u amma,surely u wiil answer my prayer. thks amma listing my prayer, malaysia 2015-04-22
Rupa Thank you mother for the favor granted. I hd sought your blessing and protection for Marilyn Remedios who had met with an accident and slipped into coma. Mother of Good Health, its only with your blessing and care, she has regained her consiciousness after about 16 days and progressing towards a normal health by the day. Thank you once again dear mother for hearing my and so many peoples' prayers. Keep all of us blessed always..Amen!! Mah 2015-04-22
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless rishika specially for good health.thankyou amma. varahapatnam 2015-04-22
rupa Mother dear, I once again come to your recourse for granting me the blessing of good health for my mother. This moment we all are waithing for her test reports. Please help and grant the favor of a normal report. Bless her with a normal report and a healthy long life. Let your divine grace be with all of us and bless us all with a healthy and happy life always. Amen!! mah 2015-04-22
rupa Mother dear, I once again come to your recourse for granting me the blessing of good health for my mother. This moment we all are waithing for her test reports. Please help and grant the favor of a normal report. Bless her with a normal report and a healthy long life. Let your divine grace be with all of us and bless us all with a healthy and happy life always. Amen!! mah 2015-04-22
bella i want to score high marks in my xams . TRICHY 2015-04-22
C R BABU AMMA VELANKKANI MADA I BEG PLEAD AND PRAY TO GOD TO MERCIFULLY BLESS MY DAUGHTER WITH SCHENGEN VISA FOR HER TO GO ABROAD AND VISIT HER HUSBAND.AMMA PLEASE DON'T LET HER DOWN. Kochi 2015-04-22
r Than you so much amma for your love and kindness. Thank you so much for your grace. Please be with me and help me with everything amma. Amma, I pray for my ts that I may be able to finish it today. I pray for a breakthrough in sc. Please kathu kollane amma. I pray for my c job amma that I get my visa and my degree on time so as to facilitate it. Please be with me amma and bless me with everything. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattunirappu muthappanamre please please please be with me and help me. St antony appacha, st jude appacha please be with me and help me. Please help me finish my t and spearman today. slo 2015-04-22
Bhavna Mandloi Mother Merry, please tie me in holy matrimony with my boyfriend Anand Kumar. You are my last resort. I am highly depressed due to caste barrier. Mother please bless us. Bilaspur, chhattisgarh 2015-04-22
Bhavna O vergin marry please pray for my mother's good health. May she always be happy. You have blessed her many a times. I believe you and will always. Please listen to my prayers. Amen Bilaspur, chhattisgarh 2015-04-22
Baalachandiran Kunaratnam,Canada Amma please show us a miracle to our current financial hardship and Amma heal my shiukder pain. Canada 2015-04-22
Your devotee Motyher Mary, I have applied for the Passport, please get me the Passport and my documents back without any problem , please secure my future , i came to this country to secure my future and to become rich , please secure my future. Devotee USA 2015-04-22
Your devotee Mother Mary, I have applied for the Passport, please get me the Passport and my documents back without any problem , please secure my future , i came to this country to secure my future and to become rich , please secure my future. Devotee USA 2015-04-22
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-22
vinu thomas amme mathave angayude kripaykayi stothram cheyyunnu. njangal valare njerukkangalilkudeyum sambathika buthimuttukalilkudeyam kadannu pokukayanu mathave, njangalude ee avasthayil njangale kaipidichu nadathukayum, samrakshikukayum cheyyunna mathavine nanniyode orkunnu. njangulade avasthakal mari durithangalil ninnun vedanakalil ninnum mochipikkan angayude puthran thamburanodu njangalku vendi mathyastham vahikkanamennu njangal apekshikunnu mathave.. KOCHI 2015-04-22
Terence Gonsalves Mother of Velankanni I pary that help to get another job and I can look after my family nad thier needs and let there be love joy peace in our family Marouli Church, Mahul Road, 2015-04-22
Michael Ma, good morning and thanks for all your blessings and graces showered and you please take care of all our needs and wants. auh 2015-04-22
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us from all evils, dangers and accidents and please forgive our sins and forgive those who sin against us and lead us not into temptations but delivery us from all evils. Amen. My savior please bless this day with peace success and fulfill all my work for what I have come to be fulfilled and as per my request please have my work done and completed as per the dates given to my management. My savior please help me to work hard and make things possible, without your blessing I can achieve anything on this earth.my savior please come to my aid and protect me and save my job ,name and dignity in this company. My savior I need you and your blessings to work hard and complete this villa's work as per my commitment given to my MD and my boss. please bless my relationship with my MD and my boss and all my team members. My savior I need you to bless all my indents which needs to be approved ,otherwise it cant be completed ,I need your help and blessing to make this happen. My savior please come to my aid and protect me and my family and please forgive m sins and please give me one more chance to prove my self. My appraisal is due in July and all this problems will have direct impact on my increment and promotion and please my savior help control my ego anger and work hard ,I beg you and I don't know what is happening and why is this happening, every time because of my managerial skills and administrative skills ,things go wrong and I fail to complete my work. Please give me strength and confidence to work hard and prove myself and I need this job till I get better offer somewhere. My savior I need you and your blessing and I trust in my prayers and rosary I do ,please help me work hard and prove myself. My savior I need you come to me and protect me from all problems and save my job, please bless my relationship with my MD/my boss and all my team members. Please protect me from getting humiliated and insulted in front of everyone. Come to my aid and save me from all problems issues and give me strength to work hard. In your name am starting my day and this project to pls bless me to complete it as committed. O Mary ,virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds J.Dominic Vijay Kumar Dehradun 2015-04-22
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life, Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all worries. free us of all tension good house, good increment good promotion good increment. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please my family peace n happiness. Mother please bless my mom good health. mumbai 2015-04-22
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-22
shierly Mother Mary, Thank you very much for all things you had done favourable for my life as my previous request.My daughter is doing well in her studies and you had freed her from many knots which was surrounding her and i thank you from my whole heart for you had given my daughter a new life because she is your testimonial child. And also, i once again thank u for you had answered my prayers for my husband. AMEN west tambaram 2015-04-22
r dear mother todays day is very crucial day I beg you mother help us to get this shipment cleared today I need yr help on this lord I soak this request of mine with your precious blood jesus help me to loose weight also help cl at his job place open a new job door for reu and for cl too help the children change them touch them help us to say our prayers daily nothing is impossible unto thee I beg for a miracle on this also help for peace in the world and guide the youth closer unto thee your power and let love and harmony be in this world . m 2015-04-22
Jaya balihar Dear mother mary thank u lord u showed mercy upon us.my brother in law got his first chemotherapy today.please pray for his speedy recovery. Please pray for his liver enzymes. Thank you lord .please pray for his stable mind. Please pray for my friends husband to get a job.may some miracle happen lord.They are very much in trouble. Mr Rajiv verma is without job for past 1 yr now.please pray for their family. My friend minni has been facing serious health issues. Kindly pray for her. Jamshedpur Jharkhand783 2015-04-22
VINIL JOSEPH DEAR VELANKANNI MATHA, I AM RESIGNING FROM MY JOB ON LAST OF THIS MONTH (APR)WHICH IS THE ONLY INCOME FOR ME,MY WIFE,&MY CHILD,DUE TO JOB PREASSURE.I HAVE NO IDEA WHAT WILL DO FOR INCOME.ALSO HAVE DEBT AROUND RS 45000. SO I BEG WITH HUMBLE AND WITH TEARS FOR YOUR HELP KINDLY DO NEEDFUL AS EARLY AS POSSIBLE ERNAKULAM 2015-04-21
merin susan thomas MY mother pray for us.my daughter suffering from the diseases such as low bp, excessive bleeding deficiency in iron ,food allergy. fear, lack of self confidenc heart valve complaint etc may be corrected. her life partner may be blessed with a higher post and my elder daughter may be posted in the same office so that her family may be live in together thanks amma thomas Manjeri 2015-04-21
merin MY mother pray for us.my daughter suffering from the diseases such as low bp, excessive bleeding deficiency in iron ,food allergy. fear, lack of self confidenc heart valve complaint etc may be corrected. her life partner may be blessed with a higher post and my elder daughter may be posted in the same office so that her family may be live in together thanks amma thomas Manjeri 2015-04-21
Rosely Ouseph mother mary please pray for my son now he is in a difficult situation in his job ma please hear my prayer. india 2015-04-21
Litty Antony Ante amme orupadu prashnagalal njan valayukayanu. Oru samadanavum aniku ella. Jeevitham maduthu pokunnu. Njan thalarnnu pokunnu amme. Ante amme ante jeevithathile prashnagalum matti tharane. Anne anugrahikane.ante alla vedanakalum mattitharane. chenni 2015-04-21
Litty Antony Ante amme orupadu prashnagalal njan valayukayanu. Oru samadanavum aniku ella. Jeevitham maduthu pokunnu. Njan thalarnnu pokunnu amme. Ante amme ante jeevithathile prashnagalum matti tharane. Anne anugrahikane.ante alla vedanakalum mattitharane. chenni 2015-04-21
Nilam Lakra Dear Mother Mary, You know very well that why I am so much under depression, please hear my prayer have mercy on us. We have lots of faith upon you, do miracle on us. You always help us during our trouble time please don’t leave us. with lots of love Ranchi 2015-04-21
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Help her to breathe on her own, eat and walk again. Lord have mercy on us all, Amen. Malaysia 2015-04-21
2015-04-21
Jaya balihar Dear mother Mary, my bro in law Satyajit john balihar is suffering from lung cancer.He is undergoing treatment in tata memorial hospital mumbai.His liverenzymes r not decreasing because of which he is not able to get chemotherapy.He is in the 4 stage.please pray dat his liver enzymes decreases.everytime he goes to the hospital there is some obstructions because of which there is delay in treatment. Please pray for him. Jamshedpur Jharkhand7 2015-04-21
ESHABELA HORO HOLY MOTHER,I am suffering from mental depression.My life is without any job and marriage.I am preparing for competition exams since 2007,but till now I have not got any success .My age is 30.I am very much worried about my future.MOTHER ,please show me right path and shower your blessing upon me. RANCHI, JHARKHAND 2015-04-21
daughter Mother please pray for us and bless us ... Mother please be with me and save me from all evil and devilish things and people. May our family enjoy peace and harmony through Jesus, help me to get back the stolen clothes and jwellery. Please pray for me , my children and husband. adsf 2015-04-21
V.christina Dear Mother please pray for me,Amma i need your help,please bless my family ,amma please my husband come back wit me & wit my daughter,amma please change my husband bad behavior to come good person,amma please forgive my husband sin,he doing bad things pls change him amma,amma i trust u,surely u answer my prayer,thank you amma listing my pray. malaysia 2015-04-21
V.christina dear mother tomorrow i am doing new project at my working place please bless me the project come successful.thank u amma malaysia 2015-04-21
P Amma, please show me what problem that I have in my body. Please cure me. Being a female I am scared of my hair fall and baldness. Please amma, I have to be presentable in my workplace. Please help me. Please make this contract signed by the respective managers. Please help me. p 2015-04-21
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.bless my village amma.thankyou amma. varahapatnam 2015-04-21
tini Some years ago my friend Vishnu met with an accident and that time one of his nerve was damage and now he is suffering from that, and some time blood coming from his nose and ear, doctors told him that after some years it's will fully affect him.Please pray for him to recover From this CHENNAI 2015-04-21
Theresa Marion Amma im offering my friend's daughter, AKSHAYA. She is 1 year old and being detected with Leukemia. Doctor have said it is at the early stage and can be cured. please help the child and clean her blood. they are middle class family and my friend had to take unpaid leave for six months for her child's treatment. Please amma..help the little child AKSHAYA to come out from this problem. Amen MALAYSIA 2015-04-21
Anusha kanna Dear mother thanks for u r kindness, blessings on me tomorrow I have a exam please pray for me to Jesus I am depending on u Jesus ...Amen... guntur 2015-04-21
shilpi sood i am longing for a life partner . i like a guy gurchetan sandhu.. my height is 5'8 nd his is 6 feet... i found him perfect for me,, pray to lord master that show him .. touch his heart regarding me...thanks simferopol 2015-04-21
PM I am thankful for my health reports coming clear as well as my daughter getting admission in the desired school. I am very much grateful and thankful to dear mother. Mumbai 2015-04-21
M Please forgive me ma! Please forgive me heartfelt Chennai 2015-04-21
C R BABU Amma Velankkani Mada I beg plead and prayer from the bottom of my heart to have mercy on our daughter and bless her with schengen visa to visit her hhusband.Amma I beg you to not let down our prayer. Kochi 2015-04-21
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-21
Jaya balihar Dear lord I pray for my brother in law Satyajit john balihar.Today he will be having his liver enzymes test.Have mercy on us lord.If his enzymes would be controlled today he would get chemotherapy today.please pray for his satble mind.His treatment is getting delayed because of which he is suffering so much.please pray for his good health. Jamshedpur Jharkhand7 2015-04-21
basil mother mary kindly pray for good relation with my wife and subside her tantrum wayanad 2015-04-21
Jaya balihar Dear mother mary I request u to pray for my friends husband Mr Rajiv verma to get a new job.He is been without job for more than a year.Now they r facing financial problems. Please pray for the whole family. Jamshedpur Jharkhand7 2015-04-21
vinu thomas Oh mother mary, thanking for your daily blessings on us. Hail Mary, as you know, upon your kindness, i got a job at Dammam shipyard one month before. But now, there is a vacancy ay Drydocksworld dubai which is a better one than the other. Oh mother mary , i would like to get the new job offer as you know there are many financial issues to be settled. Oh mother of good health, kindly give me wisdom in choosing the right on and the best also. KOCHI 2015-04-21
jennifer Dear Mother, Thank you mother very much for this day and for all favours granted> Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless us sort our family dispute> mother please bless my dad eternal peace. Mother please bless avi n me of good health n job satisfaction. Mother please free avi n me free worries n tension. Mother please bless my family peace n happiness. Mother please bless my mom good health. mumbai 2015-04-21
Anusha kanna Dear mother I am going to take exam now please help and pray to Jesus please it must easy question paper have to come.... Amen... guntur 2015-04-21
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-21
susan Rev Father.Please Pray for the Good Health of my family susan lindsay and ruma and baby Nick Alexander and Maria. Thankyou Father. visakhapatnam 122 2015-04-21
Kavitha Henry Mother mary amma pls have mercy on me amma iam in so big problem amma pls help me I dono what to do iam having lot lot of problem amma pls pls bless me and have mercy on me amma that nothing bad should happen to me amma so much of problem I am having your seeing all my problems right amma may 1st my son's birthday is there I don't have money amma pls arrange and give me the money amma pls help me and pray for me amma next month I don't have money to celebrate my son's birthday amma what my children did so much iam hard working but iam not getting any kind of result amma pls do me some thing and help me amma pls arrange for the money for my son's 1st year birthday amma iam having so much of hope pls pls help me amma and love me amma pls I beg you pray for me with your son jesus Christ amma Amen. Bangalore 2015-04-21
asha minj Mother mary.we have no one.we are orphans.today people are pressurising us to leave the land which our parents have left for us.threatening us of demolishing and breaking our house where we live.we dont have anyone to stand with us.we are running from this office to that to save our land and house.no one hears us.all kinds of corruption involved.we dont have lumpsum money to give to the officials so they dont even look at our case.give justice to us.stand with us.fight for our right.save our land and our house.dont leave us alone. gharghoda raigarh(chhatisgarh) 2015-04-21
asha minj Mother mary.we have no one.we are orphans.today people are pressurising us to leave the land which our parents have left for us.threatening us of demolishing and breaking our house where we live.we dont have anyone to stand with us.we are running from this office to that to save our land and house.no one hears us.all kinds of corruption involved.we dont have lumpsum money to give to the officials so they dont even look at our case.give justice to us.stand with us.fight for our right.save our land and our house.dont leave us alone. gharghoda raigarh(chhatisgarh) 2015-04-21
Sheeba Amma,In my parents home more problem because of that land problem.Please help my parents and my sister. Please Amma,solve this problem quickly.We are afraid about that opposite parties.please help my parents, and my sisters's family.You know how solve this problem.Please Amma.... Kuwait 2015-04-21
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us from all evils ,dangers accidents and please save my job in this company ,mother Mary I hardly anytime for fixing this Villa's work am really in problems my savior pleases come to my aid and protect me from this problems and please show me way for this issues and my savior I beg you I need your blessing grace and protection to save my job,humiliation and insults am going to go through in next 7 days ,my MD and my boss will never live for the blunder I have done. My savior I beg to forgive me and please give me chance to work hard and complete this work and have it done without further delay ,I'll be no where and I don't have a job ,am just putting happy face in front of everyone ,Internally am dyeing and scared and worried about my future and humiliation am going thro'. Please come to my aid and forgive me for doing such things and help me over come all my problems and save my job and dignity in this company. Mother Mary only option I have is to live this world and go and along with my family. Please save me and bless this day with peace and success a. In your name am starting my day and ending this day also with you. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary ,virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Beloved god and man pray for us. Amen, Rgds, J.Dominic Vijay Kumar Dehradun 2015-04-21
daughter Mother please pray for me .... and thanks a lot for all your blessings... Mother always remain with me , my children and also my husband... may your peace and tranquility be with us adf 2015-04-20
asha MATHAVE !!!! OTHIRI NANDIYUNDU ENTE PRARTHANA KETTATHINU ETHRA NANDI PARANJALUM MATHIYAVILLA HEAL MY CHINNU COMPLETELY I PRAY kerala 2015-04-20
Aravind M Potadar Prayer warriors, Please pray for me to get the job in IGATE. Today is the final round of interview and I don't to miss this opportunity. I think whatever growth I succeed in my life is because of mother Mary, Jesus and our almighty. Please pray for me for my job. I have to get this job as I am jobless since from 3 months and running out from financial crises. So please pray for me. Bangalore 2015-04-20
n please i dnt get married to that usa guy that my dad sending propsal karntaka 2015-04-20
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously, help her to breathe on her own, eat and walk again if its God's will. Lord have mercy on us all, Amen. Malaysia 2015-04-20
MANIMEGALAI My name is rajesh my mother name is manimegalai she got stomach pain went to hospital they took some test and they are saying likely to be like cancer please pray for my mother and she must get well soon I must come along my family for feast on sep 8 so please please pray for my mother KGF 2015-04-20
Russell Mother please help me.Make me emotionally, physically and mentally strong.heal me mother. perth 2015-04-20
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-20
V.christina dear mother pls pray for me,i need ur help amma ,pls change my husband bad behavior to come good person,pls he back wit me & wit my daughter, pls bless my family amma.thank you amma listing my pray ,i pray all things in your name amma,pls pray for us amma. malaysia 2015-04-20
mahesh Dear amma please bless my family.give good health to my parents.bless kanna rishika vijaya for good health.give me government job amma.bless pond amma.thankyou amma. varahapatnam 2015-04-20
suchitra vijay Dear Amma, pls. Help us my husband is without job for 5 months.pls. Help him to get the job soon with the good package. And also for me also give me a good job as soon as possible. I took 2 yrs break after my baby born so not getting proper job. Especially looking for my old office itself but the are saying no vacannices. Me and my husband shld get job as soon as possible. chennai 2015-04-20
VR Dearest Mother, you have always been listening to my pleads & cries, am in my 35th week of pregnancy mother, bless me safe delivery, me & my husband have struggled alot mother.This is our only hope, I have realized lot of things during this process.As doctors have told, my delivery should happen only after 37 weeks mother, I want all happiness for my children, let them open with the smile on their face, we both realize the importance of parenthood mother, also we are alone here, please send someone to take care of my twins mother, am worried about it.Please mother.Also forgive me for my harsh words when I fight with my mom.please forgive me.I have the blood test again on wednesday, let all be normal mother.Amen Bang 2015-04-20
TJC Mother please have mercy on me please heal my stomach pain it is unbearable, mother your powerful intercession be on me and your right hand touch my body to heal from all the diseases and evil powers. i surrender my entire my life and my family members to your powerful intercession . please have mercy on me and on my family. please heal my deadly unbearable stomach pain. Thanks Mother for having mercy on me and healing me. In your matchless name i pray in the name of jesus christ amen. hyd 2015-04-20
Thevaapriyaa Amma my puppy Jojo is having a conjunctivitis problem maa. Amma her right eye is red in colour with yellow-green discharge maa. Amma she feel very pain maa. Amma please bless Jojo to be fine maa. Amma please bless her eyes to be normal maa. Amma please bless her to be healthy and happy always maa. Amma please bless her to get well soon maa. AMEN... Malaysia 2015-04-20
mrudula Holy mother ,my father has been suffering from witchcrafts since 8 months which is done by a lady for 2 times in a period of 8 months as my father asked her to pay loan debt as he works in bank.again she did on last saturday for the 3 rd time. she want to kill my father,she wants his death.she is giving money to her colleques to do this black magic to my father.his health is spoiled totally.severe vomitings and motions amma.we need transfer also amma.please migrate us from this jadcherla to a new one.give us transfer amma.even transfer letter request also not being forwarded to higher authorities by d.g.m..please give us transfer wherever it wil be good for us.also pray that the lady evil things should be banned at my father,stop her in doing these things.punish her and her colleques amma severly.we are suffering and being in troubles amma.give my father good health,he should bound back his energy back.he should get deliverence from all evil bondages,evil spirits.pray that what the hell the lady does to my father those should not even come nearer to my dad..u throw them far amma.give my father long life amma..heal him ,touch him amma,and laso pray for our transfer amma we should get transfer as early as possible and my dad should relieve from that bank as early as possible. mahboobnagar 2015-04-20
Baalachandiran Kunaratnam,Canada Amma please jeal my soulder pain and do miracle for our financial hardship. Canada 2015-04-20
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-20
paulraj Amma Madhavee, Kindly pray for Almighty God and your son Lord Jesus Christ to bless my family, my son, my son's studies and long time. Also, pray for me to get the job in the same company and regularize our visas. Amen USA 2015-04-20
vinu Oh mother of good health,thanking for your daily blessings on me. Thanking for creating and acting for us in generating opportunities towards our house damage reconstruction. Oh amme njangal nanniyode ninte alavatta kripaykai sthothram cheyyunnu. kochi 2015-04-20
Michael Ma, I thank and praise you for all your blessings and graces you have showered on me and on my family. Ma, please help my daughter to retain all that she had studied and excel I all her papers. Ma, you correct her papers and please help her to achieve all that she wanted for a good cause. bring a suitable life partner for her. bless my mom, niece, sister, daughter, me and my husband let the holy sprit protect us from all evil. bring a suitable life partner for my niece and a good job. Ma, protect our land. Help us to clear all our debts and loans and to build a blessed home. auh 2015-04-20
Sheeba Amma, Please help my father to solve the land problem and finance problem.But we don't want court,case fighting,quarreling etc..we want peace of mind. Amma now my father and my mother is very sad because of this land and finance problem.You know amma, my father's financial position.Today he is going to ask the money to finance company.Please amma give to him the money.please help him.Please Amma.....Solve the problems quickly. Please Amma.... Amma, Please give good health to me and my family members.I have some problem and my son feels ear pain,nose problem,neck problem,and he affected with fits.he is taking medicine from the last four years.please Amma give good health. My daughter has some problem.some hair is growing on her upper lip and on her finger.please amma,help her and cure the problem if any. Amma bless my family and my parents and my sister's family. And guide us. Kuwait 2015-04-20
stacy Mother Mary pray for my brother santan he is taking anything wasting his money shouting for family and friends not listening for anyone he is working in the hotel diwar goa mother mary gv him blessings & remove on his mind who came make him get well soon pray for my sister to get nice boy to get married goa 2015-04-20
stacy Mother Mary pray for my brother santan he is taking anything wasting his money shouting for family and friends not listening for anyone he is working in the hotel diwar goa mother mary gv him blessings & remove on his mind who came make him get well soon pray for my sister to get nice boy to get married goa 2015-04-20
Johan Ammae nirakannirodannu njn wthu aerhuthunath njn snehikkuna all aennaw sharikkum ignore chaeyunnu karyam aenthannaennu ariyilla adutha varshm pulli varrae kalyanam kaikkum ammae adhehathinnu aennae onnu manasillakannae njn ethu varae ethra adhikkam arraeyum snehichittila ..aella dhivasavum emotionalayi annu njn erikkunath aenntae sneham onnu manslaki adhehm aentae jivithathil varannae ammmae i m begging u aennae kaiorhiyarutgae aennikarumila.... k 2015-04-20
Johan Ammae nirakannirodannu njn wthu aerhuthunath njn snehikkuna all aennaw sharikkum ignore chaeyunnu karyam aenthannaennu ariyilla adutha varshm pulli varrae kalyanam kaikkum ammae adhehathinnu aennae onnu manasillakannae njn ethu varae ethra adhikkam arraeyum snehichittila ..aella dhivasavum emotionalayi annu njn erikkunath aenntae sneham onnu manslaki adhehm aentae jivithathil varannae ammmae i m begging u aennae kaiorhiyarutgae aennikarumila.... k 2015-04-20
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension, good house, good increment. Mother please bless us sort our family dispute. Mother please bless my family peace n happiness. Motherplease bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me goodhealth n job satisfaction. Mother please bless my mom good health. mumbai 2015-04-20
j Thanks a lot for changing the behavior of my husband. Please continue to bless me and my family.Please protect us from illness.I submit my and my son's all illness to your foot. Please release us from that. a 2015-04-19
2015-04-19
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to help my mum to breathe on her own, able to eat and walk.Please heal her miraculously if its God's will. Lord have mercy on us all, Amen. Malaysia 2015-04-19
ABRAHAM PHILIP PLEASE PRAY FOR ME TO WIN A KERALA LOTTERY TO FULFILL MY FINANCIAL NEEDS THIS WEEK OR TIMES TO COME. THANKS chengaroor,kerala 2015-04-19
ABRAHAM PHILIP PLEASE PRAY FOR ME TO WIN A KERALA LOTTERY TO FULFILL MY FINANCIAL NEEDS THIS WEEK OR TIMES TO COME. THANKS chengaroor,kerala 2015-04-19
ramya mathaa romba kastam eruku... en thambiya (karthik)nenacha... enna life matha... avana kappathu matha.. avanoda noya gunamakku... enga life satisfy pannu.. avonoda wifeku manamatram kodu... romba kastam erku matha... na jaiib pass panna arul puri.... nagaercoil 2015-04-19
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love, please do not forsake my loved ones. Amen. -- 2015-04-19
Manaswini Mother Please bring my husband back on 25th. I want him here. I want him to be loyal to me and not go with anyone else. Bless me mother to get success in all my projects and get new ones. hyderabad 2015-04-19
SM Dear Amma, you know I'm going through some very hard time and you know I came and requested for certain things . I'm going through deep trouble ....help me with my situation and redeem me Chennai 2015-04-19
mrudula Holy mother..my father is suffering from severe gas problem, don't know himself wtz happening in his abdomen..Please heal him amma.he should get deliverance from severe ( chronic gas problem) mahboobnagar 2015-04-19
SOPHIA K.P ENTEA ECHAYAN KUWAITIL JOLIKKU POI AA JOLI POKUKAYUM ASUKAM BADIKKUKAYUM CHEYDU EPPOL JOLI ELLATHEA KASHTAPEDUNNU MATHAVEA PLZ ENTEA ECHAYANEA RAKSHIKKA PRARTHIKKANEA MATHEA.ENTEA ECHAYANU ETHRAYUM VEAGAM JOLI SHERIYAKKI THANNU ENTEA ECHAYANEA SAHAYIKKANEA MATHAAVEAAAA. NJANGALEA SAHAYIKKAN ENI AMMAKKU MATHRAMEA PATTUUUUUUUU PLZ HELP FOR MY ECHAYAN TRIVANDRUM 2015-04-19
2015-04-19
mahesh Dear amma please bless my family.give good health to my parents.bless rishika kanna vijaya for good health.give me government job amma.blesspond amma.bless vijayawada flat.thankyou amma. varahapatnam 2015-04-19
Hemalata Plz god help ma husband to cum out from al his financial problems.... bangalore 2015-04-19
Hemalata Plz god help ma husband to cum out from al his financial problems bangalore 2015-04-19
AmolorpavamaryAmma Amma heal my mother from gall bladder stone and heart disease.I fully trust u amma my mum is 80 years old now she cannot so operation BT only u can heal her mother. Through yr miracle my mum can b healed.I trust u I will come to yr shrine vellanggani . Ipoh 2015-04-19
ra Ponnamme. .. Please give good education to my youngest daughter. Please give confidence and courage to face the difficulties to both my daughters. Please protect my youngest daughter from humiliation and insulation. Please..please Give her good loving and sincere friends.Amme. ..It is very difficult to console her. Please help me to sort out all the problems. Ì am apologise for any mistake I have done. Thank you for all the blessings and support. AMEN yr 2015-04-19
alice My name is alice plz pray for my health should improve and my office audit is there my audit should go well no problem should cum in auditing and this year I wnt to get married plz pray for me this year my marraige should fix with good boy. Plz pray for my audit go welll.. mumbai 2015-04-19
alice My name is alice plz pray for my health should improve and my office audit is there my audit should go well no problem should cum in auditing and this year I wnt to get married plz pray for me this year my marraige should fix with good boy. Plz pray for my audit go welll.. mumbai 2015-04-19
Antony JM " OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US".Ma praying for my medical check up,ma tomorrow is my company medical,bless me ma that everything should go well,everything should go well and normal ma Thank you ma. AUH 2015-04-19
C R BABU Amma Velankkani Mada I beg and pray with all humility and mercifully seek God's blessings in getting schengen visa foru daughter to visit France and meet her husband sand spend time Amma all my hopes are in God I have immenace faith in God and I pray profusely. Kochi 2015-04-19
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-19
2015-04-19
ak Dear mother thank for u kindness,love on me please pray for my parents, brother, sister and my well wishers pls make me write exam good and pls change my mind am asking dis wish in d name of Jesus to ahovadeva....Amen t 2015-04-19
Michael Ma, Good morning and thanks for all your blessings and graces you have showered on me and on my beloved family. Ma, please take care of all our needs and wants, especially bless my daughter and protect her from all evil and evil doers and bless my mom, my sister, niece and my husband and me and bless and protect our land and bless us financially and clear all our loans and debts. and help us to find a suitable builder to build our blessed home. thanks and love you ma. auh 2015-04-19
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth, peace of mind and protect us from all evils, dangers and accidents and forgive our sins and forgive those who sin against us and lead us not into temptations. Mother Mary first pleas help me control and stop my ego ,arrogance and harteness towards others. My savior I need your blessings, grace to live in this world. This job is given by you and with your grace I was able to take my family and give them better life ,please don't take it away from me ,they are so dependent on me and my wife she has given her best to me and my family ,today she is going so much of health problems, am not able to solve this issues,please my savior her good health m please cure her stone problems I have promised to give silver kidney if this solved and I need you bless her with good blood counts and her bones are also very weak. please save her my savior I need your blessing and protection to my family. My daughter is growing day by day and she needs me and my wife for her to guide and protect her and correct her .Please my savior she will be getting holy communion on 2nd of May 2015 ,please bless her so that everything goes well without and problems and issues, I'll be not here for next 10 days I don't know how will she manage everything, please give he strength and confidence and please protect my family in my absence safeguard them form all evils, dangers and accidents. Mother Mary I have tried my best to fulfill my daughter and wife's dream please bless me and give me confidence to so that I can do more better with your blessing and grace. My savior I need your blessing and grace so that everything goes well, with this tension of my work I don't know how ill everything go well. I have serious problems with my MD/my boss and my team ,please resolve this issues and give me strength, please save my job, name and dignity in this company ,mother Mary please bless my relationship with my boss my MD and all other team members and forgive my sins and forgive those who sin against us. My savior I need your blessings and grace to stay in this company for another 1 year so that I can make some more saving for me and my family. My savior end of the day its my family which I need to take care and keep up my dad's name who has given me so much and helped so much when I was in problems and my savior your the main for all my success and prosperity. I need you please give me confidence and strength work hard and answers all my MD's and Boss queries and build a good relationship with them .Mother Mary please bless me so that I can complete the Villa's work and move ahead with another job ,as of now I don't have any projects and my care looks very bleak ,there is no stability in this company ,if my MD decides he doesn't like me then am on roads, this more of saving the seat and playing dirty games against each other.Mother MAry there are no opening's anywhere ,where were I apply its getting rejected and am really scared what will happen to me .Mother Mary I have started my novena dn I trust in my prayers and your miralces ,to complete this work without any further delay and problmes,i need everyone's support and materails and workmanship o complete this work. Mother Mary please come to my resuce and save my job ,save me form getting insulted ,humlated in front of everyone.I beg you only and afall atur feet to forgive me and give me chance sot aht everything goes well without any further delay. Please save me from getting shouting from my BOss /my MD and team mates. Please bless this week and this day with peace and success. In your name am starting this day and this week and ending this prayer request. My savior I still have loans of 3lacs on my head and please bless me to save alteast 2lac this year and please bless me so that I stay in Delhi for another 2 to 3years. Everything is in your hands. I place all my sorrows. Pain and happiness at your feet and Altar and as you to save me and my family form all problems and please keep us united and give us strength and confidence and with lots of love and affection. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-04-19
Your Devotee Mother Mary, Iam applying for Passport please get me passport as early as possible , find me a good partner Iam waiting for her for a long time , remove all the problems that iam facing right now,bless my mother and brother , secure my future and their future also . Devotee USA 2015-04-19
H.Rojes amma thayea please pray for vijiliya physical Problem we are hopefully belive you only ma please stay with us ma show your mersius miracle please ma please tirunelveli 2015-04-19
neha please amma shobu and i get married please and i get dha/moh in my first attempt and secure a good job in dubai karntaka 2015-04-19
Amy caroline Hi mother Mary, I need attend an interview on today,pls give me the courage to answer them without any hesitation and I need this job mother Mary pls help me on this Malaysia 2015-04-19
Amy caroline Hi mother Mary, I need attend an interview on today,pls give me the courage to answer them without any hesitation and I need this job mother Mary pls help me on this Malaysia 2015-04-19
Amy caroline Hi mother Mary, I need attend an interview on today,pls give me the courage to answer them without any hesitation and I need this job mother Mary pls help me on this Malaysia 2015-04-19
stephen coelho Dear People Of God, Please pray to Jesus and Mother Mai to bless all my work for this week and give me success in all that i do. Thank you Jesus praise you Jesus Love you Jesus. Stephen a servant of Jesus. Mumbai 2015-04-19
asha MATHAVE NANDI !!! EHRATHOLAM NJANGALE ETHICHA AMME INIYUM ULLA KARYANGALILUM SAHAYICHU ANUGRAHIKKANAME AMME KAIVIDALLE kerala 2015-04-18
Dato Annathurai Kanniapan My beloved mary mother your always in my heart in my family even i am a hindu i pray mother mary day /night and all the time what i pray to mary it will take 100% confirm . so long i am tring to a doto ship title and it comes ture from mary mother i make a friend with facebook with one of is name tan sri mahuumad niam we know is past one month he working in pahang with king pahang one day i post request can i get a title for dato and he gave me all the applation form and i sumbit with tan sri and i apply for title dimp because but i like title dsap it is very hard to get title dsap when i sumit my applation form i pray to dimp but i get the approvrd for title all my mother praying .bless my family when my title sure my family wiil be there for mother blessing .now i got the offer letter for the title for dato mother your are so greats mother in my life. hail mary/hail mary/hailmary/hailmary/hailmary/hailmary/hailmary/hailmary all the things my family get from mather mary . malaysia 2015-04-18
Sandeep Holly Mother Mary Help my brothers wife to have normal delivery and boy baby to support our family. Also help her in surviving this difficult situation. Thanks Chennai 2015-04-18
Anon Blessed Mother Mary, ever virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-18
2015-04-18
Binu Mother..Thank you for everything you have done for me.Now am in trouble. Please help me to solve all problems in my restaurant such as staff and food issues.Also please help my son to talk. He is not talking. Thank you amme. Please help me Orlando 2015-04-18
mahesh Dear amma please bless my family.give good health to my parentsand rishika give good strenth to walk.give me government job amma.bless vijayawada flat.bless pond amma.thankyou amma. varahapatnam 2015-04-18
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ to heal mum miraculously if its God's will and protect her always. Please help her to eat, breathe and walk again.Lord have mercy on us all, Amen. Malaysia 2015-04-18
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ to heal mum miraculously if its God's will and protect her always. Please help her to eat, breathe and walk again.Lord have mercy on us all, Amen. Malaysia 2015-04-18
Shamin noronha Mother Mary please cure me by your miracle power keep us in good health mumbai 2015-04-18
Shamin noronha Mother Mary please cure me by your miracle power keep us in good health mumbai 2015-04-18
Antony JM "OUR LADY OF GOOD HEALTH VELANKANNI PRAY FOR US".Ma today I said my 5th week novena,ma coming monday my yearly medical check up, bless me ma to do my medical well and fitness certificate get issued soon.Ma bless all my family members and family friends.Thank you ma. AUH 2015-04-18
Sandeep Holly Mother Mary Help me in getting my leaves to enjoy with my child. Also help me in surviving in Saudi Arabia for the earnings and return back to India for betterment in my life. Help us to sort our family issues asap. Thanks Chennai 2015-04-18
C R BABU Amma Velankkani Mada I beg plead and pray with all humility to have mercy on my daughter and bless her with schengen visa for her to go abroad and meet her husband for few days.Amma I beg with all humility and pray. Kochi 2015-04-18
mrudula Dear mother mary, my father is suffering from witchcrafts since 8 months. He works in bank.a lady customer did black magic to my dad as my dad asked her to pay loan debt.so my dad and our family wants to leave this place and migrate to new place.so my dad applied for transfer to hyd.he submitted all documents to higher authorities. But that man (d.g.m) is torturing my dad that he don't want to give transfer to new place to my dad and he even not sent the documents of request to hyd.amma please help my dad amma.we need transfer to hyd ..Please change d.g.m attitude at my father and send documents to hyd before the last date.we should get transfer at any caust amma.we don't want to stay in this place amma as we r suffering from witchcrafts, black magic, evil bond ages mahboobnagar 2015-04-18
D. Mathangi Narayanan Arul niraintha Mariye vaazhga karthar ummudane. Pengalukkul aasirvathikka pattaval neere. ummudaya thiru vayitrin kaniyaagiya yesuvum aasirvathikka pattavare. Archiya sishta mariyaaye, sarvesvaranudaya maathave, paavigalaai irukkira engalukkaaga ippozhuthum engal marana nerathilum vendi kollum. Mathave, ithu ennoda second pregnancy. Ithula enakku low lying placenta nu sonnanga 20 weeks. Athu mela poidum nu sonnanga but 32 weeks aagiyum innum pogala. 23rd April thaan doctor kitta appointment. Baby vera koncham perusa irukkum pola. Naan kutty a iruppein ungalukke theriyum. Pls mathave en kooda thayavu senchu irunga. Please maathave enakku normal delivery aaganum. Mathave ungaloda arul naala enakku first delivery normal aachu aana ennala promise panna maathiri Velankanni vara mudiyala. Thayavu senchu enna manichu please intha delivery la enakku help pannunga. Naan nalla padiya intha kozhanthaya petru edukanum normal delivery moolama. Please maathave. Enakku ungala vitta vera yaaru irukka. Neenga oruthar thaan enakku help panna mudiyum. naan enna thavaru seithu irunthaalum please athai mannithu arula vendum thaaye. Nandri mathave. Your dearest daughter, D.Mathangi Narayanan Chennai 2015-04-18
2015-04-18
viji lord please save my son from hte calamaities please let him understand his mistake please help him get back to us please bring the peace to my family back ubited 2015-04-18
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-18
P Amma, please do a miracle. Please let me get a good news on Monday about the job confirmation. Please help. p 2015-04-18
p Hail Mary, full of grace. The Lord is with you, blessed are thou amongst women and blessed is Thy fruit of Your Womb Jesus. Holy Mary Mother of God, pray for us sinners, now and at the hour of our death. Amen. Please give me job confirmation Madhave. p 2015-04-18
AmolorpavamaryHea Heal my mother from gall bladder disease and heart problem.She is eighty this year she cannot go fr operation BT u can heal her mother.I have faith in u. Look. Malaysia 2015-04-18
shyla Please pray for my son and husband both of them have white skin patches on their face & body. Dubai 2015-04-18
sura Dear Mother , Please Pray for me to get a job as soon as possible , I am struggling with my house work , please find someone to sell my land as soon as possible .Alos for me to get a good price for the land . amen syd 2015-04-17
stephen C Dear People Of God, I thank very much Jesus, Mother Mai and you people of God for all the blessings , grace and petitions received during this week. Thank you Jesus Praise you Jesus Love you Jesus. Stephen a servant of Jesus. Mumbai 2015-04-17
Kavitha Henry Mother mary amma pls have mercy on me amma soon I should take all the golds from the shop before aunty comes from London amma pls help me amma and soon I should get one good shop for my office amma pls help me amma if iam not giving her gold she will talk very badly amma pls pray for me amma and help me amma nothing bad should happen to me amma pls give me the money amma to pay my house rent and the cheat amount amma iam in so big problem every thing your seeing how much iam suffering no amma pls help me and do for me some thing amma pls amma bless me amma till iam there in the shop give me good business amma pls help me and bless me amma don't leave my hand and don't lend my head down amma pls bless me and help me amma iam alone facing so many problems gods is giving me so much of money problem and personal problem but god is not given me money tension and of problem amma still how much I have to suffer will see amma so much of problems iam facing amma ,,,,amma iwant to come up in my life what wrong is there in that amma tell me I should come up in my life and I should buy own house for my daughter and son I should leave with them happily with them for how many years iam there in this world amma pls bless me and help me amma but don't give me the problem ;give me happly life amma iam not doing any wrong thing to any one amma pls pls pray for me with your son jesus Christ amma to solve all my problems soon and to leave happy life with out any tension amma pls bless me and always be with me amma your the only one person to help me amma pls have mercy on me amma and soon my son have to talk and walk amma with your blessing and my daughter and son should study well amma with out any problem pls give for both of them good memory power and good habits amma bith are your children amma pls bless them and be with them always amma Amen. Bangalore 2015-04-17
m Maa Velankanni my wish has come true just be with me and keep my baby in good health am afraid of losing it..plzzz maa protect the baby..will always remain indebted to you..amen Mru 2015-04-17
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and protect her always. Help her to eat, to breathe and to walk. I know deep in my heart that Lord Jesus Christ will help her.Lord have mercy on us all, Amen. Malaysia 2015-04-17
manaswini Holy Mother, please make me get very big projects and i clear all my loans and give the best of everything to my children. I am suffering from the last so many years mother due to financial difficulties.please bless me to have lot of money to pay all loans, salaries, and have a good life. I have been suffering for so many years mother. Please give me relief in every aspect that I am suffering. Also for the last one year I have been trying to come to your shrine and have not been able to. Please bless me to come there in May Hyderabad 2015-04-17
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-17
V.christina Dear Mother Mary please pray for me,i need ur help amma,please change my husband bad behavior,come to a good person ,Amma pls help me my husband come wit me & wit my daughter , Amma pls forgive my husband sin all, thks amma listing my pray, malaysia 2015-04-17
mahesh Dear amma bless my family.give good health to my parents.give good health to rishika kanna vijaya.bless rishika she has to get good energy then she has to walk.give me government job amma.thankyou amma. varahapatnam 2015-04-17
Josephraju Dear Mother, My sister in Law she is pregnant, I am praying to you so that her delivery time no problem should come to her and her baby health .also I am praying you to get job in Mumbai itself. And Please bless me and my whole family with good health, good wealth, peace of mind and protect us from all evils, dangers and accidents and forgive our sins and forgive those who sin against and lead us not into temptation but delivery us from a evils amen. Chennai 2015-04-17
ANJANI TRESA MATHEWS I kindly request to transfer to a main branch so that I can study for ex and loans so that I can excel in my field Field Irinjalakuda P o. thrissur 2015-04-17
ANJANI TRESA MATHEWS I kindly request to transfer to a main branch so that I can study for ex and loans so that I can excel in my field Field Irinjalakuda P o. thrissur 2015-04-17
C R BABU Amma Velankkani Mada I beg plead and pray to God to have mercy on our daughter and bless her with schengen visa to join her husband and spend time with him.Amma please bless herewith visa. Kochi 2015-04-17
ak Mother pls pray for my health... Mother plse and pls pray for future in the name of Jesus Christ to ayvay deva pls...Amen... g 2015-04-17
Prof.Y.Xavier irudayaraj amma...! pray for my good health .,thank you very much for given to me agood family .my father.,daughter,wife. my daughter studying +2 ,to get high marks&MEDICAL SEAT my job ...good admission our college my wife ..good health.. I HOPE ONLY YOUR GRACE...ALL THESE THINGS ARE CAN EASILY DONE BY YOUR GRACE.... PULIANGUDI 2015-04-17
Prof.Y.Xavier irudayaraj amma...! pray for my good health .,thank you very much for given to me agood family .my father.,daughter,wife. my daughter studying +2 ,to get high marks&MEDICAL SEAT my job ...good admission our college my wife ..good health.. I HOPE ONLY YOUR GRACE...ALL THESE THINGS ARE CAN EASILY DONE BY YOUR GRACE.... PULIANGUDI 2015-04-17
jojibabu mother i beg beg beg beg beg beg t u amma please forgive my sins amma in the name of jesus christ i beg t u amma ur wish amma not my wish amma mother i beg beg beg beg beg beg beg beg beg beg beg t u amma today i will admit evening amma in hospital for nose surgery amma neeve nak toduga vundu amma jesus my daday neeve doctorga vundi operation cheyyi tandri who r admit in hospital who are in surgery god touch and heal give good health in the name of jesus christ i beg tu amen. isubmit hospital surgery room anesthisea doctors nurses,operational equipments ,medicines ,entire hospital and me all patients i submit in the name of jesus christ neme amen. go i want ur protection ur blessings amma mother i beg beg beg beg beg beg beg beg beg t u amma kanapalli lo koratalu teerchina talli munige navanu kapadina talli siluva krinda vunna talli na todu vunda ga ra va amma amma amma i beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg t u give good health amma touch complete my body amma in the name of jesus christ i beg t u amma amam amen.ma family ki todugu vundu variki diryem prasadinchu amma mother who are suffering health ,wealth financial family children jobs marriage chorrochota vunn avru amma all priests amma nones belivers non belivers amma i submit ur lovedfoots amma beg beg beg beg beg beg beg beg beg beg beg beg t u amen. hyderabad 2015-04-17
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-17
vinu thomas Oh mother mary, thanking for your blessings. Thanking to you for providing for us basic necessities of life,livinghood and other necessities.Oh mother mary, we are moving through difficult faces in our life . Kindly give assistance in facing those troubles. Oh amme, kindly pray to your immanuel for us. KOCHI 2015-04-17
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-17
jennifer Dear Mother, thank you mother very much for this day and for all the favours granted> mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi nme good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion good full time maid. Mother please bless my family peace n happiness. Mother please free avi n me of all worries n tension. Mother please bless my dad eternal peace. Mother please bless us sort our family dispute. mother please bless my mom good health. Mother please bless us get a good full time maid. mumbai 2015-04-17
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-17
Beena Mathavae njn agrahicha allku varae oru relation undaennu kaellkunun bt njn ath vishvasikkunilla allankil adhehm aennodu parayumayirunnu.karthavae njanjaludae marriage nadakkanae..pulliyudae paduthamkaiyunnaa varrae njn wait chaeyamm mathavaenjalludae karyamnadakkanae..prarthikksnae..pulli enjottu thannae varannae ammae kochi 2015-04-17
Saluja Mathave you know my weaqknesses i lose heart when iam continually disappointed in my search for a job and when a job which i like goes to somebody else.endless waiting shatters my hope .Friends have got jobs through bribery and unfair means.iam in a distressed mind.People are making fun of me .i gave an interview last month and was selected as a teacher and was given appointment letter but due to some people playing conspiracy i lost the job on 1st april 2015.Mathave i want that job itself as soon as possible.according to your will and in the place of your choice.I do believe fervently that nothing is impossible for you and perform miracle in my life also by granting me the job i want.Amen. Bhubaneswar 2015-04-17
Saluja Mathave you know my weaqknesses i lose heart when iam continually disappointed in my search for a job and when a job which i like goes to somebody else.endless waiting shatters my hope .Friends have got jobs through bribery and unfair means.iam in a distressed mind.People are making fun of me .i gave an interview last month and was selected as a teacher and was given appointment letter but due to some people playing conspiracy i lost the job on 1st april 2015.Mathave i want that job itself as soon as possible.according to your will and in the place of your choice.I do believe fervently that nothing is impossible for you and perform miracle in my life also by granting me the job i want.Amen. Bhubaneswar 2015-04-17
J.DOminic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us form all evils,dangers and accidents and forgive our sins and forgive those who sin against us. Mother Mary am in real problems where I can be thrown out ,I accept my mistake for not taking action and this is because of my ego and arrogance. Mother Mary my savior please come to my aid and save my job ,name and dignity in this company ,my savior I don't know what will happen I don't have good boss or a god father above me to save me and protect me ,for its only you other than you there is no one on this earth who can protect me and save me form all my problems. I beg you please bless all my IT things to work well and please get my approvals done on priority and because of my mistake I have tell leis please pardon me and save me I beg you this last time am going to do this I'll never do this again, my savior I know please forgive m me am trying my best to get every a good job but no one gives me or helps me ,my savior where is problems why is this issue and I don't know this all happening because of my ego ,or irresposbbilities ,mother Mary please come to my id and protect me and forgive me for my sins and please have this villa's work completed and save my job. Mother Mary I beg my only focus is t get the Villa's work completed and for that I need your blessing guidance and protection ,please bless me with good team and show me way fro my survival ,I feel company doesn't want me anymore ,because the way am treated and harassed by these ladies and mother Mary am insulted and humiliated in front of everyone and anyone ,its only you can solve my problems and punish those who does this to me ,am frustrated in life and I have lost interest in this company ,I don't where will I go ,every time there is problem in my job ,because of this my family is effected and they get into such mood that the whole peace o f min goes off. My savior please come to me and please bless my vendors so that they can help me and solve this villa's problems .My savior please come to my aid and protect me ,if this villa's job is completed as per th dates without any further delay I'll donate 2001 rs in your shrine this is my promise and when I get new job I'll shave my head and kneel and come to your holy tank for forgiveness and thanksgiving. You have saved me form so much of problems and protected and given this job to me and because of you only we ar enjoying this lifestyle ,please my savior save me form my MD my boss and my Team members ,pls protect me from people who are doing bad to to me at my back ,is only you can save me and please bless my relationship with my MD, my boss and my team sot hat everything goes well. Please bless this day with peace success and prosperity and protect me from all evils, protect my job my dignity and all my IT infra. In your name am writing all the mails to my MD/my boss and pls bless all my communications and for me its you who is my god mother god father is my Jesus your beloved son and all my happiness pain and sorrow are shared with you and place at ur feet for thanking and help. Save me from all legal issues and bless this day and week to go well. In your name am starting day and ending this prayer request . O Mary, virgin before childbirth keep me pure in soul and body, O Mary ,virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.DOminic Vijay Kumar Delhi 2015-04-17
mary Ente Parishutha Amme, Thank you very much for everything that I received through your intercession. Amme I take this opportunity to say my heartfelt thanks to you. Amme please pray for us, stay with us, protect us from all evil things which may destroy us. Amme please bless our daughters to grow in strong faith. Amme please open good opportunities to my daughter sneha as only because of your intercession she completed her study. Please be with her always. Amme please bless steffy as she is in 12th std. Please guide her, protect her, be with her all through her life. Amme please guide and stay with my husband as he will be a blessing for our family. Amme millions of thanks to you. I pray this in the name of the Father, the Son and the Holy Spirit, Amen. delhi 2015-04-17
shierly Amma madhavae, Please help my daughter to do her model exams well, Please pour your courage to face the exams and give her your strength to write the exams fast and answer the questions correctly and pass out in all the exams.please be with her through out her life as she is your child. she is suffering from many problems and please clear all the problems surrounding her and shower your blessings on her and clear all the problems. AMEN west tambaram 2015-04-16
Your daughter Please cure our sickness me and my sister to get rid of white patches in skin as this will affect our future,Please pray for us please amma please pray for us and let miracles happen in our life.I am very much worries bout our future please ma please pray for us Coimbatore 2015-04-16
shierly Mother mary please be with my husband as he is very tensed in his job for his boss behaviour is changed totally as he is the best friend to my husband but now he is treating my husband as an enemy which could not be tolerated by my husband. They are trying to make my husband to getout of the job of his own.i dont know what made the boss to treat like this.Please change the boss mind and make friendly as before sothat my husband will do the job sincere as before. thanku madavae west tambaram 2015-04-16
asha AMME !!!MATHAVE!!! bless my daughters to do the exams well and score good marks kerala 2015-04-16
asha MATHA !!!relieve my children from the addiction to mobile give them practical knowledge kerala 2015-04-16
2015-04-16
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Lord have mercy on us all, Amen. Malaysia 2015-04-16
Baboo Mathews Dear mother , please bless me financially so that I can fulfill my daughter dream to become an engineer , I thank you o mother that by blessing of yours she got admission in govt college based on marit but now education cost is around 6 lac. I m facing too much difficulties in arranging fund, please bless with ur miraculous action. I m coming there to pray in velakannni Kuwait 2015-04-16
your disciple Thank you mother. After sending my prayer request to you my life has started moving. Hyderabad 2015-04-16
vinu thomas Oh mother mary , thanking for your daily blessings and care. Oh mother mary, i am constantly facing lot of troubles and problems in my life. Hail mary, kindly give me strength to come out of these problems succesfully KOCHI 2015-04-16
M Banu Amma! Mathave! Please pray for my uncle son. And give him honesty, good habit, kindness heart. Please explain my tears and family situation. I tried for past six months. I cannot see any response from him. He always cheating and fighting me. so I am suffering. He does come with me. He does not marry marry me. He will decide to marry another girl. He does attend my phone calls. I cheated by him. Please cure this heart burden Amma!. I want to see him. Tuticorin 2015-04-16
neha please mary i get married to shobu and i get dha/moh in my first attempt please a get a good job please and my health also becomes good karntaka 2015-04-16
AN Mother Mary, Please pray for me that my shift timing is changed so that I can spend more time with my family. Please pray that my sister gets married soon to a nice person, Thanks! Gujarat 2015-04-16
MONCY THOMAS O Holy Mother. Still waiting in hope that my prayers will be answered. Feeeling sad and insecure. Please send the happy news. New Delhi 2015-04-16
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-16
daughter Mother please pray for me... my financial upgradation should take place without trouble... please help me on office and family front ... be with me mother...please be with me asdf 2015-04-16
V.christina dear mother Mary,pls pray for us.pls help me to bring my husband come back wit me & my to daughter .pls change my husband attitude,pls forgive him. tq amma listing my prayer, malaysia 2015-04-16
Kavitha Henry Mother mary amma pls help me amma my aunty is coming from London and I have to give her the golds back amma pls bless me and help me in some of the way amma I should give back her golds soon before she comes amma other wise it will be a big problem amma pls help me and bless me my time also its not good know amma pls bless me and help me amma pls pls because of me pray to your son jesus Christ amma pls help me amma I be you ammadont leave my hand and pls amma be with me your the only one person to help me in every thing amma pls mother mary you have helped me in so many thing even in this matter pls bless me and help me amma pls amma I dono how to express my problem with you amma pls amma iam having lot of money problem amma pls pls give me good money and solve all the problems amma soon when I will have peace of life with out any money problem amma and pls help still I have not given my house rent also amma pls help me amma in my office no business also amma my business is under los los amma no baddy should get so much of problem amma pls bless me and help me amma love you lot listen to my prayer amma till iam her pls give me good business and good admission and good money amma Amen. Bangalore 2015-04-16
Gliffa Borges I request you to pray for my beloved brother Mave Borges who is surrounded by the Evil Spirit which controls him from getting closer to god. This has lead to various changes in his behaviour as he is turning very egoistic and stubborn person day by day. Also he is disrepecting and hurting his own parents by one or the other way. Please pray for him let God guide him and Holy spirit take control over him. karwar, karnataka 2015-04-16
alice Dear Mother please pray for my health. I am not keeping well. My head is paining and I am disturbed. I am getting burning sensation in my body. Mother please tell Jesus to touch and heal me. Mother I am worried a lot. I am not not able to keep concentration in my work place. Getting disturbance in my prayer. Mother I am tensed and worried. Mother only you can understand me. Mother Jesus is above all doctors. Mother please help me. Take away all the fear and doubts from my mind. Give me the grace to pray more and more. Mumbai 2015-04-16
mahesh Dear amma please bless my family.give good health to my parents bless rishika for good health.give me government job amma.thankyou amma. varahapatnam 2015-04-16
Ravi purohit Dear mother of all, I would first want to thank you for what ever you have done for me in this life and would always pray to you and Lord jesus Christ than answer everybodys prayers .my prayer to you is please get my life janice back to me and melt the hearts of my family as well as her family.please get us United my mother , please do a miracle my mother. Amen lonavala 2015-04-16
Shaleen Grace Ma,thank you for all the happiness and goodness you have blessing me with. Sorry for all my mistakes. If u think that Shamin Singh Sidhu is not the right guy for me,I'm willing to forget everything about him. I'll let him go happily. For once I want to live my dreams.I don't want to end up being a fool all the time. Show me the rightful signs. Amen. india 2015-04-16
r Thank you so much my God. Thank you so much for all the blessings in my life. Thank you so much for being with me through everything. Amma, I pray for my meeting with df today that things may work out in my favor. I pray my c job that it may not be taken away from me. Amma, I pray that I get my visa on time. Amma, I pray that my defense goes well and that I succeed. Please let me be able to present a fool proof case and be able to handle any tough questions. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattunirappu muthappanmare, st antony appacha, st jude appacha I pray to you. I surrender my life and my happiness in your hands. Please be with me amma all the days of my life. Kathu kollane amme. Koode undayirikkename amme. slo 2015-04-16
shinu Mother Mary we thank you for all the favors recd.We thank you for the chance we got to visit your altar.Help us & heal all manpower with your grace & faith.Lead us in your way always.Help us to get our needs fulfilled .Amen Bhopal 2015-04-16
Susheel P Please pray for me my mother that my car gets sold at a very good price, i will give a offering whatever is possible from my side. Please help me so that by selling this car i can clear my debts to a certain extent. Bangalore 2015-04-16
ponnu amma maathave i dont believ in anyone.i prayed my mom everyone with tears. at last result he blocked me and my mom from facebook. he hates me. from my childhood i ahve prayed.prayed to mother mary with all the trust..now this is what i get..i prayed even if its not for good also i will bear it.still this is all what i got.so father everything is fake right?the rosaries me and joseph recited the curches we went the masses we attented ellam waste .right.. my life is gone right. let it be let it go.. amma you fooled me right?you gave me temporary happines..you agve me him you took it also..good amma.goodd... y keep me in world take me away bangalore 2015-04-16
2015-04-16
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-16
vinu thomas Oh mother mary ,thanking for your daily blessings and kindness. Today. , authorities from my church had come to my home to transfer an amount of rs.10000 towards our house damage. Thanking to you for acting on them on behalf of us. KOCHI 2015-04-16
Kumud Pls pray for my son snehal fill with holy spirit . Mom thanks for your protection to snehal save him every evil. Mom thanks for pearl to give her everything . Mom we offer pearl at your feet. Mom pray for our sins . Always stay with us with your divineson Jesus . Amen Anand 2015-04-16
b Dear Mother, please pray to safely rescue my husband from the extramarital affair and to restore our marriage. we also pray that the Lord helps the other woman to forgive my husband. May she too understand and come out this relation safely and peacefully and set my husband free. May Jesus comfort her and bless her future. Please mother intercede to your son Jesus and He will answer our prayer. Amen. mumbai 2015-04-16
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health,good wealth, peace of mind and protect us from all evils, dangers and accidents and please forgive my sins and forgive those who sin against us, lead us not into temptation and delivery us from all evils amen. Mother Mary you know my suffering ,for money sake I have sold my self respect and today am questioned ,humiliated and insulted in front of everyone and anyone. Mother Mary I don't know what will happen to me and my life and my career and where will I go if I lose this job, am really frustrated because of my Boss 's behavior and the way she speaks to me and insults and humiliates me, there is not other way for my survival or new job. My savior if this continues one day I'll surely leave this world and go off along with my family, because I don't have so much of money to survive without job, it will be back to square one again ,my savior there is no way fro all this problems ,humiliation ,I know our lord Jesus Christ went through all this before he could attain the heaven and start serving us. Please forgive me for my sins and please help me over come all my problems and complete this IT work at Villa's this has become major issues and I need these problems to be sorted out and I need the approval for certain things which are very important for the villa's and I need your support and help ,my savior I don't I beg you fall at your feet please take me from t his mess which I have created for myself and I need your blessing and protection to save my job, name and dignity in this company ,am writing this prayer with lots of pain and suffering ,am totally distributed in my life I need your blessing and grace to over come all this please give m strength to work hard and over come all these problems and please guide me ,my boss my MD will not spare me ,I have spoilt my name and dignity in this company ,I was able to complete this project in good way ,but now just for such small one am suffering and not able to go forward ,I agree its my mistake I need you please forgive and save from this problems for the last time. Mother Mary I need you and you blessing ,please guide me and help for the last time and allow me over come all my problems and issues ,please bless this day with peace success and protect me from getting insulted or humiliated in front of everyone. My savior I need you and your blessings to overcome all my problems issues and pleas forgive me for my sins and forgive me for those sin against us. Please save my job ,and please give me better job where I have some peace of mind and I can work on my own and give 100% ,mother Mary am mentally distributed and sacred for my life and my family. I hardly have 10 days time to complete this work I don't know how will I complete it without you blessing and grace. My savior pls help me over come all my problems issues and bless this day with peace and success. In your name am raising these intends and am telling lies because of m mistake pls forgive me for the last time and show me way for all this problems. Pls bless this day with peace success and prosperity and forgive me for my sins. O Mary ,virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-04-16
M Banu Amma! Mathave! My uncle son must marry me. He must come back and live with me.He must love me. Tuticorin 2015-04-16
Harrish mary matha, This is my first exam of my sixth semister.So i had a aim.I want you to give me the shine and aasir.Please I want become like my rolemodel and I want to give feel like my rolemodel to others.And i want to become Fearless Guys like my rolemodel and easy to speak with others and In my family to all you give the shine and AASIR...Please mathavae..I want to become like my rolemodel and i want to place in zoho... chennai 2015-04-16
daughter Pray for me mother ... be with me in all my doings, in my thoughts and actions... please mother guide me and give me the ability to raise my children and look after them in the best way ... help my children to speak well and gain the goodwill of their teachers and friends ... help them to build confidence and bring glory to God's name.. adf 2015-04-16
R Mahalakshmi AMMA VELANKANNI MATHA PLEASE BLESS ME. AMMA MY PROBLEM FINANCIAL PLEASE AMMA ALL REMOVE FINANCIAL PROBLEM PLEASE SAVE ME, PLEASE HEALTH ME, MY HUSBAND. AMMA PLEASE BLESS ME. Secunderabad 2015-04-16
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen -- 2015-04-16
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension, good house, good increment good promotion good full time maid. Mother please bless my family peace n happiness. Mother please bless my mom good health. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my mom good health. mumbai 2015-04-16
2015-04-15
M Banu Amma! mathave! please pray for me. My (blood relation)my beloved uncle son must not marry any other girl except me. I cannot accept that. Because we lived one day like husband and wife. He told false in this matter.I cannot live without him. But he decide to marry another girl. Please stop this thinking to him. He remember me. He must come back and marry me within few days. I want his kindness. I want his love. I want to meet him. I want live with him. He must not treat me as enemy. god's grace He must come with me and live my house. Tuticorin 2015-04-15
M Banu Amma! Mathave! My uncle son (My beloved blood relationship) lived me like husband and wife contact. But he does not marry me. he will decide to marry another girl. I cannot accept this. But I cannot give any complaint. Because sincerely I love him so much. My heartily pray for him. I want to see him as a honest person. this my long and long dream. Please respond this prayer and help me Amma! Tuticorin 2015-04-15
Caroline Murugan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Lord have mercy on us all, Amen. Malaysia 2015-04-15
neha please amma i get maried to shobu and i clear dha/moh in my first attempt please amma and i secure a good job in abu dhabi or dubai karntaka 2015-04-15
Suresh Thanks Amma for praying for us Bagalore 2015-04-15
manaswini Mother, my prayers to you to make my son free of medicine and give him excellent health. Make him the best keyboard player and let him win laurels in body building and his education. Hyderabad 2015-04-15
MANIYAN PARAMASIVAM amma. I love you amma. I am sorry for all my bad behaviors i did so far amma. i need you to be with me and bless me forever amma. i love you.. make me so perfect and very clever , very lucky, being so respected, very very superb communication skills, never let anyone tease, very good sense of humor, very happy, being so so active, smart, very very studious, very very good memory power, very good minded, I want you to bless me forever amma. be with me and bless me forever amma. i love you amma. being so healthy, very learning ability, being master in everything very fast, and working like a master in master class, very fast acquiring skills amma, i need you amma. i want you to be here always amma. make me very very clever, very superb communication skills, very very superb understanding ability, very fast planning skills and very fast plan executing skills, amma. i love you amma. and i need you amma. be with me and bless me forever amma. getting success in everything very fast amma. with your blessings maniyan paramasivam tirupattur 2015-04-15
maniyan paramasivam amma. i believe in you and i trust you amma. i want you to bless me forever . thank you. i love you amma. TIRUPATTUR 2015-04-15
mahesh Dear amma please bless my family.bless my parents give them good health.bless rishika give her good health and she has to eat food nicely.give me government job amma.thankyou amma. varahapatnam 2015-04-15
n Ammae achachm orupadu proposels varunnundu kaettitu aenniku sahukkan vayya echirudae mumpayieunankil ethu nadannaennae ammaekaivadaruthae eth nadakannae achchn aentae jivithathil varannae varrae oru proposum nadakkaruthae ammae plss amnae aenniku vaendi prarthikkanae....ammae plsss k 2015-04-15
r Mathave, I pray for my meetings with tk and gf today. Please let things work out in my favor. Tahnk you for being with me amma. slo 2015-04-15
ak Dear mother thanks for u r kindness on me u wrote exam well today and please pray for my future. . g 2015-04-15
ponnu amma mathaave ammaaaaa kaii vidalleee..i really believe in you i trust in you.you are the oone who made us together..i told you i am soorrryy i wont repeat it again.please maathaave please ask jibbin to come back to me.maathaavee i know you never leave me you will hear my cry.i trust in you bangalore 2015-04-15
Thevaapriyaa Amma tomorrow I have Taxation Test maa. Amma please bless me to do well in this test maa. Amma this test got three section maa. First topic is about Individual Tax Computation, second is from Capital Allowance/ Industrial Building Allowance and the third is about Withholding Tax maa. Amma each test is 25 marks maa. Amma please bless me to get a very easy questions maa. Amma please bless me to do this test well maa. Amma please bless me to remember everything maa. Amma tomorrow my test start at 9am maa. Amma please bless me to be on time maa. Amma this test is for 2 hours maa. Amma please bless me and be with me always maa. AMEN... Malaysia 2015-04-15
appu my sister app writing all the entrance exam please give her sucess always ammmaaa..prathikunnu India 2015-04-15
Deepak This is Deepak from Coimbatore, me and my brother are running business in Coimbatore, and it is down, nothing is helping out, financial problems are occurring to run business, applied for loan, loan is also not sanctioning out, don't know what to do, everything is getting so difficult, we want to run it successful, but no help. Vailankanni ma, I have a great faith trust in you, don't know why, but u have helped me in difficult times, and is still helping. Amma plz hear my prayer from the bottom of my heart. Please do something for us, so that we can become successful in life, and make all obstacles get cleared. Please ma.. Coimbatore 2015-04-15
Vinay Kumar Narisetty Mother please help me mother.People who have negative feel on me make them to understand.Even they teat me bad and hate me give me patients.Make me not to sin.Forgive my sins mother.Pray for me and help me mother all the time.Thanks mother.Help me from all the people treating me bad. Chicago 2015-04-15
valsamma Amma please pray my daughter to get a job pandalam 2015-04-15
V.christina Dear Amma ,pls bless my family .pls answer my prayers amma, i need u help amma, pls pray for us amma, pls change my husband attitude, pls change his mind, pls forgive his sin, pls he back with his family amma, amma i trust u ,tiz miracle will happen to me.. Amen. malaysia 2015-04-15
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-15
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful, free us of allworries free us of all tension good house, good increment good promotion. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. Mother please bless avi n me of good health n job satisfaction. Mother please bless my family peace n happiness, Mother please bless my mom of good health. mumbai 2015-04-15
Michael Ma, Good morning and thanks for all your blessings and protection and graces showered on me and on my family. Ma, I place all my trust and hope in thy mercy and grace. I know you will help us all to succeed. thanks Ma auh 2015-04-15
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-15
r dear mother I beg you to pls help cl for his driving licence as the same is submitted to the authorities but we have not received as its now a big problem for obtaining licence and renewal but ours is lost satan is trying his best to spoil and block this but lord you open the door and eyes of mercy on the officers help us to get the licence renewed for another 10 yrs too without any problems I beg you lord I soak this request mother with yr intercession and yr love pls intercede with yr son to get our licence renewed and I beg you for a miracle mother jesus my this request i soak it lord with yr precious blood mother don't let me down I beg you help us to get our licence today as we're called again today and nothing is impossible unto thee you can do anything I trust you mother help me to testify on yr love and mercy help mother to get our licence also help all the people who would be coming there to get their paper. help the children in school help all the sick heal them I beg you we pray for peace in the world and spl take care of the youth draw them closer unto thee. today I believe you'll grant my request and we'll get the licence renewed for another 10 yrs I beg you mother help this is impossible I know but you can do this touch all the officers there, help cl to change his job or get a better salary open door for us mother m 2015-04-15
M Ammae kathukollanas oro dhivasavum njn vaedhanayoda jivikkunath achchn kueaw proposals varunnu ammae aennikariyilla aenthu chawyanamaennu achchn aentae lfill varannae ammae njanjlkidayil oru pashnavum ellathae njn agrahicha all thnae aentae lfill varannae ammae kaividallae..prarthikkanae ammE k 2015-04-15
MB Loving me and my husband are not keeping too well. please keep us healthy. I have applied for my teaching job in school as English teacher, please take care of it. My husband will also come to know this month end weather his company will work or wil be shut. it will be very difficult for us to survive , give loan back and take care of kids. please pleas take care of us. New Delhi 2015-04-14
MB mother my son in law is looking for better job please help him. My daughter is staarting with her own work . people who are meeting her next week , bless her so she can work with them very well and they are happy.please help them and also my sister should be having work. they are having a difficult time . please bless them so they can get their bread and butter. they had a big house which they had to sell it and now they are living in 1 room house, no job. plesae help help help. New Delhi 2015-04-14
sneha roy madave amme njan snehikunna dipu chettanumayi ente kaliyanam udane nadathi tharaname....thadasagal mattitharane.....njagal orumich kudumbajeevitham nayikan kazhiyaname.....ethrayam petann dipu chettan enne kaliyanam kazhikan kripa choriyane amme...jeevitha kalam muzhuvanu dipu chettante bharyayi dipu chettante kude santhoshathode jeevikan anugrahikane ammen idukki 2015-04-14
sneha roy amme madhave njan snehikunna ente dipu chettanumayit ethrayum pettann ente vivaham nadathi tharaname..thadasagal ellam mattitharaneme...ethrayum pettannu thanne njagalk orumich oru kudumba jeevitham thudagan anugrahikaname amme....oru karangal kondum njagale thammil verpirikaruthe amme...dipu chettante bharya ayi jeevitha kalam muzhuvanu dipu chettanod oppam jeevikan enne anugrahikane amme....dipu chettan ethrayum pettann enne vivaham cheyyane amme.....amme madave ente abesha upeshikaruthe.. ammen idukki 14/04/2015 2015-04-14
JHONSON ANTHONY Dear Mother Please help me i need get the bank loan to settle all my debts help me to obtain the loan. Mother guide me and protect me to settle my personal issue. i have lost my passport need get back please help and Thank you for showing all type people in my life and give me strength to overcome all this. i need you touch me mother heal me bless me as i am alone now. help mother help mother help mother Amen amen amen Kuala Lumpur 2015-04-14
Kiruthika I want my brother(he is not blood relation) Sarles Raj to speak with me.i need my brother as like before.i want him to realize my love.more misunderstanding keep on going between us.please god,i need my brother's love.please.i beg u. Thanjavur 2015-04-14
Tricia Our Lady of Velankani, I want to come to your shrine but I am unable since you are not calling us... Our Lady please help us settle the Mangalore property so that the favour is in our side and we get the money which would help me and my sister for our future. Please help me and my husband to get a good job so that we would be able to fullfill our dreams and our sons dream I want to visit your shirne with my parents and father in law please call us..... Mumbai 2015-04-14
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and protect her always. Lord have mercy on us all, Amen. Malaysia 2015-04-14
SAI My mother is suffering with cancer (last stage). Please give her good health. vijayawada 2015-04-14
m Ammae achchntae kaiyil ninnu oru posotive ans kittanae..achchnae lifill kiitannhm prarthikkunu ammae kathu kollanae kaividallae plsss aaa kudumbathil pokan njn kurae agrahichu ammae kaividallae... k 2015-04-14
m Ammae achchntae kaiyil ninnu oru posotive ans kittanae..achchnae lifill kiitannhm prarthikkunu ammae kathu kollanae kaividallae plsss aaa kudumbathil pokan njn kurae agrahichu ammae kaividallae... k 2015-04-14
Niya Ammae vallarae sankadathodannu njn parayunnath ammae achchn aentaelifeill varanae yathoru thadasavum undakkaruthae ammae kanninnu prarrhikkunnu ammae achchmtae kaiyil ninnu positive aya oru result undaknaw aenniku jivithathil achachnae kittanae ammae njn orupadu vishvasikkunu aenniku vasendi prarthikkanae kaividallae ammae...urachu njnjn vishvasikkunu amnae kaividallae K 2015-04-14
Niya Ammae vallarae sankadathodannu njn parayunnath ammae achchn aentaelifeill varanae yathoru thadasavum undakkaruthae ammae kanninnu prarrhikkunnu ammae achchmtae kaiyil ninnu positive aya oru result undaknaw aenniku jivithathil achachnae kittanae ammae njn orupadu vishvasikkunu aenniku vasendi prarthikkanae kaividallae ammae...urachu njnjn vishvasikkunu amnae kaividallae K 2015-04-14
Jacob Akhil Francis my loving mother Mary I attend the 10th Board exam I wish to need 98% for all subjects and I need a good entrance coaching and a good future.Pls pray for me allappuzha 2015-04-14
DR ANISHA CARDOZO Plz pray that i get suitable life partner of my profession a doctor settled in usa.thank you jesus praise you jesus. goa 2015-04-14
mahesh Dear amma please bless my family.give good health to nanna specially.bless pond amma.bless rishika for good health.give me government job amma.thankyou amma. varahapatnam 2015-04-14
B MALLIKARANI Bless my elder son S M Balaji paramesh a PERMANENT JOB and for a good salary and for his bride v u janani to get a job and both to have a happy married life his marriage is on may 29 2015 Mary amma please make my son a healthy steady minded without any depression and Bless my younger son S M Hari krishnan to pass in his BE FINAL YEAR AND bless me and my husband P S SUBRAMONIAN FINANCIALLY TO CONDUCT the marriage without any depts. NAGERCOIL 2015-04-14
r Thank you so much for your love and kindness amma. Thank you so much for your grace. Thank you so much for being with me and helping me with everything that I do. Amma, I pray for my job, visa and degree. Amma, I pray for my meeting with df today. Please let everything be positive. Amma, I pray for my job at c that I may not lose it. Thank you so much lord for being with me and helping me with everything. Kathu kollane amme. Koode undayirikkename amme. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattunirappu muthappanamare, st antony appacha, st jude appacha please please please be with me and help me with everything. Kathu kollane amma. Please be with me today in my meeting. Kathu kollane amma. slo 2015-04-14
daly & preethy O MOTHER WE HAVE NO CHILDRENS SINCE LAST 5 YEARS WE GET MARRIED. MOTHER MARY PLEASE PRAY & REQUIEST TO OUR LORD JESUS FOR GIVE US A HEALTHY BABY changanacherry 2015-04-14
ak Dear mother please pray for my exam tomorrow I prepared but I don't how i am going write pleas mother pray to Jesus.... g 2015-04-14
Jose Thomas Mother of Vailankanni, please pray for me and help me in my prayers. Ahmedabad 2015-04-14
M.Rajendran amma engal pirachanaikku theervu kodu shosthirem chennai 2015-04-14
Roy Augustine Kindly pray for me to Jesus through our Velankanni Matha I have fear,anxiety,and stress,feel like I am going to fall down ie all stress related symptoms.Doctors find nothing health Problems but only anxiety related things.Only God can cure me. So please pray for me Praise the Lord London uk 2015-04-14
Roy Augustine Kindly pray for me to Jesus through our Velankanni Matha I have fear,anxiety,and stress,feel like I am going to fall down ie all stress related symptoms.Doctors find nothing health Problems but only anxiety related things.Only God can cure me. So please pray for me Praise the Lord London uk 2015-04-14
A Mathavae ...achchn orupadu ptoposels varunundu ...pls mathavae njn oru padu eshtapaettu mathavae aenniki aentae achchmae lfill kittanae plsss ammae karanju kondannu nj eth aerhuthumath ammae achchm aentae jivitjathil varannae....ammae kaividaruthae...adutha varsham varrae onnjm arruthath pattaruthae oru paennum vararuthae..ammae ke 2015-04-14
Hema O Mary Mother of Good Health, Thank you for all the favors and graces you have bestowed on me and my family. Please let my son be completely OK and please remove his anxieties and fears so that he can focus. Please bless him for a very successful college life. Please remove my anxieties and fears as well and let everything be OK on the health front. USA 2015-04-14
Hema O Mary Mother of Good Health, Please grant good health to my sister who is suffering from severe menopausal problems. Please grant her good health and let her be completely OK soon. Cincinnati 2015-04-14
Josephin A Dear Mother, Thank you for all the Blessings and Love you have showered on us till today. You have always been my grace, support and strength. Mother bless me in my current neccassity, bless my family to live in peace. Grant us the grace we pray for at this very moment. Bless us Mother, who else can we go to, you our only hope.Bless us with our Visa process. I pray unto THE. Help us, our loving MOTHER. Pray for us to our loving Lord Jesus Christ, For your love sake Amen. Tulsa 2015-04-14
Vincent Nadan Mother of good health Vailankanni protect us from financial.mother i have been 3 times for seeking own home and i put a lock in flag hosting for pleading for home.protect me from diabetic.protect me from blood pressure.protect me urine infection that still not cure the skin.protect my mother violet suffering from diabetic and tooth pain. Dum Dum 2015-04-14
jancy Blessed ammae enn yandae house dae foundation nadakan pogunu ammae prathiKaenmae.oru thadasam illathae yandae veedh purthi yaki tharaenmae ammae amen yandae husband shaji mathew cancer asugathil kazinu asugam matte tharaenmae nallaa arogyathinai prathikunu ammae yandae prathana kaelkaenmae amen chengannur 2015-04-14
V.christina Amma tq listening my prayer. Amma you are of miracles in our life. Amma i need ur help,i need ur miracles in my family, pls help my husband, now he doing so many sin until he go other religion to worship & doing bad things,he told Jesus never help him,tats y he go other religion,amma i know how u AR miracles but my husband ignore all tis amma. amma i ask pls change my husband attitude & the way he thinking,and pls he back home,i trust u amma,pls pray for me. malaysia 2015-04-14
vmathew Amma please give me a job to my daughter in good hospital Amma i love you please intercede your son Jesus help me only your help please help thank you amma pandalam 2015-04-14
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health make him peaceful and normal child. Mother please avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. Mother please bless my dad of eternal peace. Mother please bless my mom good health and good full time maid. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my family peace n happiness. mumbai 2015-04-14
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-14
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-14
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us form all evils,dangers,accidents and forgive our sins and forgive those who sin against us. Mother Mary please bless this day with peace success and prosperity and please forgive my sins an give me strength to work hard and fulfill all my MD's issues and give confidence and strength to work hard and prove myself. MY savior pls bless my relationship with my MD,my boss and my team members and so that my job is saved and protected, I don't have new job with me ,mother mary everyone has job in there hand and there are opening's but for me nothing is coming I don't know why where is problems and am getting promoted or getting good hike like others. It's so humiliating and insulting ,I really get scared when I talk my MD and or my boss. My savior please come to my aid and protect my job ,please bless me so that I can complete my project at VME ,because of these small things my image will be spolit and the confidence my MD and my boss has will go please ocem to my resuce and protect me from all problems issues and please guide me and put my career in proper way ,my appraisal is due in July ,am really worried and scared ,what will I show my management and where will I go. Please comet o me please answer my prayers ,there is opening coming up in Lemon tree hotels ,as DGM position I want it my savior help me get this job and put me in good branded company where I can grow and work hard and give the best ,Here am really very in secured and going through pain in my life. My savior I need your blessing and grace and these day's I don't peace in my house or at my office. I dotn where to go and what to do am totally confused and worried about my future I have so much of commitments and loans to be cleared ,all my mother's jewels will be lost if don't make it my this year at least. As committed I'll come to your shrine if I get new job and shave my head and kneel and come your holy tank ,I need job my savior or I need good promotion dn good increment .My savior without you I can grow in life .Please bless me and protect my integrity and name in this company ,I dotn want to get insulted to humiliated or thrown out of this company .THs job is given by you and toady am in this position its only because of your blessing and grace. Please show mercy on me and my family and please protect my IT infrastructure and give me peace o mind save my job and dignity in this company. My savior please be with me guide me protect me and save me form all problems ,issue sadn save my job and give me good career growth ,mother Mary am already 41 yrs old I need you, Please all my communications and mails, and meeting to be successful and fruitful. Please bless this day with peace and success and help me over come my ego,arrogance and angry because of which my relationship is getting spolit. My savior please come to me bless me fulfill all my MD's wishes and his commands,Pls bless all his mails so that i dotn get insulted or humiliated .My savior in your name am starting this day and this week pls be with me and protect me from all problems and issues. In your name am ending this prayer show me way for clearing my loans ,my problems and give me good job. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Everythreateing danger vanishes at thy prayer . Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-04-14
r dear mother I beg you help cl as he goes for his licence work today let all be well as things are getting difficult for us be with us touch the officers and the people and the paper work I soak them lord in your precious blood for nothing is impossible unto thee. mother pls intercede with yr son for this request of mine help us in our financial situation and also help us to loose weight take care of our health & kids help us to say our prayers daily help this Chengdu shipment to be solved as all dors are closed open some door mother I beg thee, also to get our diwan payment as its already delayed thank you for the countless blessings and for hearing our cry m 2015-04-14
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-14
CLARENCE MOREIRA Our Loving blessed Mother take care of our family members peace, health & help us to clear all debts . guide & protect us from all dangers & shame.Please help us Mother, please help us Mother, please help us Mother.Amen. CHENNAI 2015-04-14
CLARENCE MOREIRA Our loving Mother help my children & myself in our jobs. Grant us happiness & peace.Amen. CHENNAI 2015-04-14
Latika your disciple Mother, I want to marry VKM without any issues. I know he loves me but he has his problems. I pray to you to make things easy fro him and make us get married. I want him to come back on 25th. I want everything for him settled before we start new life Hyderabad 2015-04-14
your disciple Holy mother, please bring me out of all these financial and official issues I am suffering every day.Please send me money to repay all the loans Delhi 2015-04-14
neha please shobu and i get married please and his parents agree and i clear dha/moh in y first attempt and get agood job please and my acidity problems resolve karnataka 2015-04-13
M.SRINIVAS Mother mary me and wife&son are jobless looking for a job bless us mother mary and also bless all those people who looking for jobs like us last year i visited with my family for your blessing at velankanni church.mother mary bless all the people suffering from illness..motherwe be beleive in a lot your blessing as always done miracle in our lifes. hyderabad 2015-04-13
B.anil Our lady of good health mother grant me my prayer through your blessings .give me your blessings and good health to your family and my brother completed M.tech(cse) give a job to him and family is in lot of money problems save me mother . Thank you for love and kindness amma &thank you for grace. rajampeta 2015-04-13
asha Mathave !!!!ente makkal nannayi pareeksha ezhuthan avare anugrahikkaname ! ee kudumbathe anugrahikkaname kerala 2015-04-13
asha Bless my daughters to score good marks in the exam cure them completely Lady of health kerala 2015-04-13
CLARENCE MOREIRA Our Loving blessed Mother please heal our family members.Help us to live in peace , guard our health & take care of our financial needs.Hep us Mother , help us Mother , help us Loving Mother.Amen. CHENNAI 2015-04-13
Alphy Amme ente milan kuttan nannayi padikane,amme eavanu nannayi ezuthuvan ulla ella anugrahavum kodukane,amme njangalude kadam vegam veetuvan sadikane,amme eniku nannayi incerement kittane, nannayi job cheyvan sadikane,amme ente pray kelkane,bennyte talakarakavum swasam muttalum marane,amme ninaku orayiram nanni,ente alankuttanu maths nu full mark kittane,avanu scholarship kittane. mumbai 2015-04-13
Kavitha Henry Mother mary amma pls help me for the money amma don't leave my hand amma having lot of problem solve all the problems soon amma pls bless me amma need to pay the house rent and the interest and the cheat amount amma don't have single amount also to pay the amount amma pls bless me and help for the amount amma why your giving me so much of problems amma not yet all happy only facing lot of problems only amma may 1st is my son 1st year birthday don't have one rupee also to do they birthday amma pls bless me and do some thing amma pls arrange the money for me amma pls pls amma having too much of problem iam not able to solve the problem amma only one thing that iam thinking your always with me amma and you will not leave my hand for any thing amma that what iam thinking for so many people your helping me so pls help me also amma don't leave my hand amma till iam her give me the business amma some customers have to come amma pls bless me and shelp me and no money in the hand having lot of problem amma pls bless me amma I don't have any support from any one iam standing alsone and iam doing every thing so how you have to support me amma even you have given me every thing but still iam asking you to solve my problems and give me peace full life full credits I want in my life amma do me somr thing and give me the amount amma pls help me and bless me amma having lot lot of tension amma Amen. Bangalore 2015-04-13
asha THANKS AMMA FOR THE BLESSINGS NANDI MATHAVA NANDI kerala 2015-04-13
Ronella Mama Mary please bless us with the gift of a healthy baby. its 3yrs since we are married. Intercede to our Lord.Amen chennai 2015-04-13
2015-04-13
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones, especially my daughter for my tribulations and setbacks. I beg Your Divine Mercy. Amen. --- 2015-04-13
Santhosh Kumar Mother mary please hear my family prayer and answer my request .I will be evergrateful to you mother. Please help me so that i can come out of the present money problem. I have applied for the personal loan , please help me to get this and loan approved mother. Please help me mother, with your blessings do this need mother. Once this is approved i will come with my to the church and pray to mother for the blessing given to my family. Bangalore 2015-04-13
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give government job amma.thankyou amma. varahapatnam 2015-04-13
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously and to protect her always. Lord have mercy in us all, Amen. Malaysia 2015-04-13
Violet Daniel Dear Lord thank you for a answering our prayer for my son to get the Sales Advisor job in BMW. He is happy with his job but he has sales target to met monthly. Please we pray that he meets his monthly target. Please Lord Jesus help my son Dexter to achive this sales target. Thank you Lord. I pray also for my dear mother in law who is in hospital for almost a month. She is having heart failure and lung infection. Please clear the infection and make her well. We ernestly pray for your mercy on us. Malaysia 2015-04-13
Violet Daniel Dear Lord thank you for a answering our prayer for my son to get the Sales Advisor job in BMW. He is happy with his job but he has sales target to met monthly. Please we pray that he meets his monthly target. Please Lord Jesus help my son Dexter to achive this sales target. Thank you Lord. I pray also for my dear mother in law who is in hospital for almost a month. She is having heart failure and lung infection. Please clear the infection and make her well. We ernestly pray for your mercy on us. Malaysia 2015-04-13
r Thank you so much much amma for your love and kindness. Thank you so much for your grace. Amma, I pray for my job, degree and visa. I pray for your kindness that you may be with me all the days of my life. I pray for my defense and all the preparation that leads up to it. You are my grace and kindness amma. Please be with me through every decision that I make and lead me to success. Please let me get my c job. Please do not let me lose it. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattu nirappu muthappnamre, st antony appcah, st jude appacha please please please be with me. Amma, I pray for your grace and your kindness in everything that I do. slo 2015-04-13
shaji Ammey went ammey Kathu kollaney ammey thanks Ella nanmakalkum mathavey kunju vavynu thannathyinu thanks ammey ammyudey sannyudyil samarpikunu ammey Kathy kollaney vavynu.ammey Anu ney anugrhikaney.ammey ent duty il Kathy kollaney ammey vishamam onnum undakalley.sambathikam ammey alatunnu ammey kanyiney ellam went munpil samarpikunu amen. UAE 2015-04-13
Anusha kanna Dear mother thank you thank you so much from my childhood onwards I didn't wrote perfectly but now in I wrote very well thank you Jesus thank u soo much I answerd 5/5 questions without mistakes mother please pray for my next exam please mother its a cryptography so please please pray mother .... guntur 2015-04-13
ra My dear velankkanni mathave. .. Kattu Rakshikkane.. Please give me peace of mind . Please motivate my youngest daughter To study and do everything well.Please direct her in her future studies and life.She is losing her all interest very fast for small failures.please give her happiness and peace of mind.please make both daughter's successful in their life.Amen. yr 2015-04-13
Claudia Dear amma,thank you for blessing ,please keep my daughters body and eyes inflammation free and watch over my family forever please ,thanking u again. Us 2015-04-13
SM Please pray that SS gets herC,NH.NC immediately and for her victory and good health also that Rephsa is victorious at work and school and that she is happy also for RSV and her baby that they both are healthy and happy that my husband is victorious and happy and that he succeesds urgently with both sofps and that I have no problems with the home and CRM and all goes well. AM 2015-04-13
rupa Oh Mother of good health, this time I come to seek thy blessing and help not for me but a lady called Marilyn Remedios from Bandra who met with an accident on the 6th of this month and now is in coma. I read about her in the newspaper today. I seek your help in her complete recovery to normal life. Please be by her side Oh Mother to protect her from anything untoward. For the sake of her husband and her two small children please give her new and normal life. Show us your miracle and come to her help dear Mother. Whoever reads this, I request you all to join me in my prayers for Marilyn Remedios in this hour of pain and suffering. Amen!! Mah 2015-04-13
Dominic Deva Thaye You have helped and guided me throughout my life. Took me to great heights that is well beyond my capability I am looking for a new opportunity, if it is the will of God and is good for my family, please help me achieve it. I submit my hopes and desires at your holy feet. Your son US 2015-04-13
shinu Mother Mary we than you for all the favors recd.We are planning to come to your altar , help us & protect us from all evils . We pray for all mankind goodness.Amen Bhopal 2015-04-13
mitten Parishudha amme, ente Sid-nu ee pravashyathe H1B visa labikkuvaan amma daivathodu prarthikkana. enne avidutha prarthanayil orkename. enneyum sid-neyum kaathukollename. thank you for being there for me :) US 2015-04-13
Lizy AMME THAYE PLEASE HAVE MERCY ON US AND FORGIVE ALL MY SINS AND HELP ME IN ALL MY WORKS AND NEEDS AND PROTECT US FROM ALL EVIL SPIRITS AND HEAL EVERY SICKNESS OF US IN JESUS NAME I PRAY AMEN Hyd 2015-04-13
Michael Ma, Good morning thanks for all your blessings & protection. Ma, please bless my Mom, sister, niece & daughter in a very special manner Ma, I wanted you to hastily help my mom very specially help my daughter to do her exams v well and u correct all her papers, help her to excel in all her papers Ma, bless & protect my mom, save her from the bad people,bless my sister today help her to obtain permanent visa today you are doing it without fail bless my niece to get a suitable life partner auh 2015-04-13
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. mother please bless my son good health, make us peaceful and normal child> Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house good increment good promotion. Mother please bless my family peace n happiness. Mother please bless my dad eternal peace. Mother please free avi n me of all worries n tension. mother please bless avi n me good health n job satisfaction. Mother please bless my dad eternal peace. Mother please bless my mom good health. mumbai 2015-04-13
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-13
vinu Oh mother mary, kindly bless me and give me inner strength to face tough situation in my life. Thanking for your daily kindness upon me. kochi 2015-04-13
V.christina Mother mary amma .pls help me, my husband left me already 1 year amma..he dont like see my face amma,tiz 1 year he never talk to me,i got 1 baby girl amma.amma pls change my husband attidude ,i wan he back with me amma,pls help us to live in peace & one family amma. malaysia 2015-04-13
LIBIN BENNY my dear amma , please pray for my exams ... I want to pass all subjest in this exams. So please pray for me.And to get a good future in my life. malappuram 2015-04-12
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and protect her always. Please give her strength and determination. Lord have mercy on us all. Malaysia 2015-04-12
Anusha kanna My dear mother please do prayer to Jesus for my exams I want to get good percentage in my PG..... guntur 2015-04-12
joe ente amma, I submit all my sorrows to your foot. Please bless us to settle in our hometown.Please bless us with a own house.Please bless me and my family. We are struggling for our daily bread. Please bless us with basic needs like food,home and education of child. D 2015-04-12
mahesh Dear amma please bless my family.give good health to vjaya akanna rishika kushi amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-12
Frederick Wright Our Lady of Good Health,Mother,grant me my prayers through your blessings.Heal my brother Tommy of his stomach pain.Heal my wife Debby's cough and keep her in good health.Bless my son,Mark, keep him in good health,help him to advance in his legal career and find him a good Catholic partner for marriage.Keep my daughter,Meryl,in good health.Keep her safe in Mumbai.When she changes her job give her the wisdom to take up the job that will be good for her future.Bless me,keep me in good health and may my work be inspiring and productive.Thank you,My Mother,I trust you and homour you for all the many gifts you have given me and my family.Frederick Wright Cuttack 2015-04-12
jd blessed mother pl give my daughter a child soon its 5 years for her marriage pl bless her also with a child soon I know you will hear my prayer soon pl mother please. mumbai 2015-04-12
r Thank you for your love and kindness amma. Thank you for your grace. Amma, I pray for your grace and mercy for my job, visa and degree. Plesae be with me and please let everything happen on time. Amma, please please please forgive me for my sins. Father Lord, Lord Jesus, Holy Spirit, Appe, kaval malakhamre, kanyattunirappu muthappanamre, st antony appacha, st jude appacha please please please be with me. I pray for my t as it is being reviewed by my professors. Please let them agree to my work . I pray for my defense and all the preparation that leads up to it that it may be great. Thank you amma for everything that you have done for me. amma, please be with me everyday of my life and guide me to success. Kathu kollane amme. Thank you so much of the pdc opportunity. Please let p happen. slo 2015-04-12
A Divine Mother,send your holy angels n roll away the stone blocking n delaying my marriage n let wonderful changes begin to be in my life from this year.Amen. India 2015-04-12
Amaloodhaya Request monther Mary's blessings for a normal and safe delivery. Coimbatore 2015-04-12
M.Rajendran amma engalai enna seiyya pokirai theivame un parivukka kathirukkirom thaye unakku shosthirem chennai 2015-04-12
Antony JM " Our Lady Of Good Health Velanksnni Pray For Us". Ma yesterday I said my 4th week novena,ma praying for my good health,bless me ma to do my medical check up.Ma praying for my elder daughter health touch and heal her stomach pain ma.Ma praying for all our family members.Thank you ma. AUH 2015-04-12
Nina PLz Mary Mother tomorrow 13.4.2015 has my best Friend Birthday plz MOther help me that he write with me and talk wit me he want write me not im plz help me mother he talk with me bcause i like so much mother only you can help me i come to yu all years plz listen help me mother my only hope in you amen Germany 2015-04-12
2015-04-12
Claudia Dear mathavee ,tomorrow going for my daughters check up ,please make her eyes inflammation free ,please give me good news ,let all her labs be normal ,please Amme ,thank you for watching over my family ,please care for them especially my children . Us 2015-04-12
saju suresh kadangalu vettuanula anugrahamthinu vendi kaliyar 2015-04-12
jennifer Dear Mother., thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please pray that god bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house good increment good promotion. Mother please bless us sort our family dispute. mother please bless my dad of eternal peace. Mother please free avi n me of all worries n tension. Mother please bless my avi n me good health n job satisfaction. Mother please bless my family peace n happiness. Mother please bless us get a good full time maid. Mother please bless my mom of good health. Mother please bless my dad of eternal peace. mumbai 2015-04-12
jojibabu amma mother i beg t u amma ur loved foots amma i beg t u amma please forgibe my sins amma in the name of jesus christ i beg t u amma beg beg beg beg beg beg t u amma ur loved foots amma saranu amma amma amma mother i beg beg beg beg beg beg t u amma please amma today i will go to doctor amma mari operation lekunda cheyyi talli ur wish amma ne saniidi ki vasatnu amma nann mannichu amma ur mercy amma love amma protection amma mother mary i beg t u amma please amma heal and touch amma in the name of jesus christ i beg t u amma medicine dawara cure cheyyi amma who are suffer like amma i submit t u amma mother wife and husband disputes amma choro chota vunnavaru amma childrens leni varu amma family ,finacial pno peace job leka i submit all probulems in the name of jesus christ amma mercy amma peace love protection amma mother i beg beg beg beg beg t u amma please amma karunchu amma saranu amma mother na wife salary repu rammannaru amma total amount ichhetatlu cheyyi amma mother i beg beg beg beg beg beg beg beg beg beg beg beg t u amma mother i beg beg beg beg t loved foots amma amma amma amma amma amma amma beg beg beg beg beg beg beg beg t u amma who are in hospital amma today operations amma i submit ur love dfoots amma i submit all priest amma 25 yersa silver jubliy cheskontunna priests ni submit chesttunnau amma ur loved foots give good health amma in the anme of jesus christ i beg beg beg beg beg beg beg beg t u amma amen.amen.amen.amen. hyderabad 2015-04-12
M Banu Amma! Please pray to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. I am and also my mother very suffering in this matter from September 26 2014. I am very helpless. Please help me. I love him so much. He must treat me kindly and affectionately. Tuticorin 2015-04-12
M Banu Amma! Please pray for me. I want to see My uncle son. He must remember me. He must love me. He must not cheat me. He must come back and live with me Tuticorin 2015-04-12
Michael Ma, Good Morning & thanks for all your blessings & graces you have showered on me & on my family. Ma please bless & help my daughter to retain all that she studied & you correct all her papers & excel in all her papers as she is working v v hard. Ma bring a suitable life partner for her a life partner as she desire. Ma bless my sister & bless her to get her permanent visa, u can do wonders ma. Please bless my niece to get a suitable life partner & a suitable job. Ma, take care of all of us & bless our needs. clear all our needs & wants Ma, please protect our sites and bless us to build a blessed home if you wish & give us good health of mind & body bless our company, mom,all our kit and kin. auh 2015-04-12
stephen C Dear People Of God, Please pray to Jesus and Mother Mai to bless all my work for this week to go smoothly and with sucess in all i do. Please all so pray and bless me today on my Birthday. Thank you Jesus Praise you Jesus Love you Jesus. Stephen A servant of Jesus. Mumbai 2015-04-12
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-12
J Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us from all evils, dangers and accidents and forgive our sins and forgive those who sin against and lead us not into temptation but delivery us from a evils amen. Mother Mary we thank you for giving us another day and we thank you for blessing my daughter's holy communion dress to come out very well. Mother Mary you have saved me and my family from so much od problems ,dangers and always showed us way fro success and prosperity and guided us as and when we are out of our way.my savior I beg you and fall at your feet to forgive me and save my job, and help me come down on my ego,arragaincy and dictator ship behavior ,my team ,my family everyone feels this ,please save me and give me strength to withstand these people who are trying ur hurt me or trying to put me down and show me way to come out this .Today my MD and all my senior members will be in Head office and please save me so that I don't come in front of them or they insult me or humiliate me in front of everyone. My savior please show me way for my job, i don't have any job in hand for me if something's happens to me or my family ,I'll b eon roads ,I have so much commitments in life and loans to be cleared .My savior help me over come all my problems issues and please give me strength and confidence to work hard and forego my problems issues and please save me and protect me from all evils, dangers and accidents. Mother Mary my savior please help me work hard can complete the project which is still pending, because of my laziness and irresponsibility I have lost my name in the company,please forgive me and show me way for this I need you my savior I need your protect ,ur grace and your blessings to succeed in life ,I cant live in this world without your blessing and grace, this job is given by you and I want to give 100% of my hard work, please bless my team and protect me from my team members who are trying to betray me and snacth my job ,mother Mary you know all my problems ,pain and happiness ,I need your blessings to cure my wife from any kond of health problems she is going through and please my savior today her health is spoil its only because me and my family for which I take the resposnbility.Please forgive me and bless her with good health and cure all her health problems and please bless my family and pls bless my daughter with good habits, good behavior and good education so that she can bring good name for me and my family, Protect her in all ways of life and please guide her and give strength and confidence to work hard and pls accept her as your child. Please mother Mary protect me from all legal issues ,problems and save my job which is very important for any one on this earth. In your name am starting my day and this week ,pls bless my relationship with my MD,my boss and all my team members ,I need your blessing guidance and pls give m strength to address all my MD's needs and save my job, end of day he deices my fate in this company. My savior don't let me down help me over come all pains ,feeling and work as team and grown in life. Please save me from getting insulted or humiliated from him ,please I beg you to bless all my indents and have it cleared form my MD and all my team members. Let all my payments get cleared and bless this month with success and prosperity. In your name am starting my day and this week, please be with me and bless all my commincations,meeting and mails with my team ,my md and my boss. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.DOminic Vijay Kumar Delhi 2015-04-12
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-12
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-12
Mary My hubby want a transfer from Chennai to Kerala.He is living along there.So very frustrated and smoking a lot.We are newly married and living seperately.We can live together only if he gets a transfer which is too difficult to get.Begging for your prayers and with a promise that we both will visit matha . cochin 2015-04-11
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Please give her strength and determination. She has progressed and I thanked You with all my heart for it.Please thank Lord Jesus Christ fo me.Lord have mercy on us all, Amen. Malaysia 2015-04-11
liji Dear mother,improve my health.... pta 2015-04-11
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-11
Leslie David Prayer for my Job and the happiness and prosperity of my family Jamshedpur, Jharkhand 2015-04-11
sharon martyle raj Amma mother with my hole heart i beg u to cure my daughter carol zaphrine because she har a hole in her heart she is only 6 months age plz mother cure her from this problem i believe in you amma u are the only mother who can help if u do this favour i will come to u and offer you thanks ave maria mysore 2015-04-11
sharon martyle raj Amma mother with my hole heart i beg u to cure my daughter carol zaphrine because she has a hole in her heart.she is going to get operation on 21 april. she is only 6 months age plz mother cure her from this problem i believe in you amma u are the only mother who can help if u do this favour i will come to u and offer you thanks ave maria mysore 2015-04-11
MBV Dear mother, Please pray for good health of my both sons, we are in so much of trouble from long time, please grace my elder son (Krish) so that he can hear (naturally) just like a normal child and please grace my younger son (Kush) so that he can speak properly. Please bless both of my children’s. Vapi 2015-04-11
JOHNSON MATHEW Mathave ente sarirathineium manasineium alatuuna ella budhimuttukalum vishamangalum maati saukyam tharaname..athodoopam ente jobilokke mathavinte anugarhaham pravarthchu nalla reethiyil sales nadakuvvan mathave anugrahikaname..athodoppam ennneium ente pappa,mummmy,anishchan,remiya chechieum ashima moleum thirumunppil samarpikunnu aapathil ninnum anarthagalil ninnum rogathil ninnum viduvichu kaathukolaname...Amen Dubai 2015-04-11
r Thank you so much for your love and kindness amma. Thank you so much for your grace. Amma, I pray for my job, degree and visa. Amma, please please please be with me and help me with everything. Please lead me on the path to success. Mathave, I pray for your love and kindness. I pray for your grace. I pray that you be with me through everything. I pray for m8 my defense date and all the preparation that leads upto it. Please let me shine on that day and succeed. Please please please be with me amma. Father Lord, lord Jesus, Holy spirit, appe, kaval malakhamare, kanyattunirappu muthappanmare, st antony appacha, st jude appacha please please please be with me and help me with everything. I pray for your love, protection and guidance in all things. Please help me get my visa before a31. Kathu kollane amma. slo 2015-04-11
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-11
Michael Ma, I thank and praise you for all your blessings and graces you have showered on me and on my family, kit and kin, church, office and all the family of the company. Ma, please bless my daughter in a very special manner and help her to retain all that she studied and do her exams v v well and please take all her papers and you correct it. bless my niece with a suitable life partner and my mom, sister clear her face make her face shine and bless her to get resident visa please bless my husband . auh 2015-04-11
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-11
Anoop Ammaa...please help me to get a job as soon possible. my days here are counted. I have no choice in my hand the only help I look from you ammaa... Dubai 2015-04-11
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will. Please give her strength and determination. Lord have mercy on us all, Amen. Malaysia 2015-04-10
asha MATHAVE!!!!! ente prarthana kettathinu nandi ee anugraham njan orikkalum marakkilla thanks for the miracle kerala 2015-04-10
asha MATHA!!! bless my daughters to do the exams very well and to score good marks i am confident that you will never betray me kerala 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Amma! Please to Allah for my victory. My uncle son must remember me. He must marry me within few days.He must not cheat me. He must come back and live with me. Iam very suffering in this matter from September 26 2014. I am very helpless. Please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
M. BANU Asalamu Alaikkum. Amma !Please due my marriage with my Uncle son. he cheat in marital matter. He realize and come back with me. I am suffering in this matter since 6 months. I am helpless. please help me Thalamuthunagar, Tuticorin-628002 2015-04-10
joanita fernandes Mama pray to jesus that i may get orders and get money for babies fees clothes money for us to go to goa bless the food i make mama pray to jesus for us and grant our petitions madras 2015-04-10
joanita fernandes Mama pray to jesus that i may get orders and get money for babies fees clothes money for us to go to goa bless the food i make mama pray to jesus for us and grant our petitions madras 2015-04-10
Louiza Tiwari My sister Siviliya Pascal age 43 years had surgery and her right breast removed due to Breast cancer on 5th April. Her removed parts sent for testing then doctor decide how much it was spread and what will be the treatment. Please pray for her speedy recovery and she will live long life. If she go through chemo then she Valankini maa give her strength courage, patience and speedy recovery. New Delhi 2015-04-10
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. -- 2015-04-10
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bles rishika she is suffering with fever and cough please give her good health.give me government job bless pond amma.thankyou amma. varahapatnam 2015-04-10
jayamala madha amma,please help my appa to recover from his illness without surgery.Please be with him and give him strength to recover.Please give my amma strengh and health.Please shower your blessing on my family and be with them.Thank you for all the blessing that you have showered on us. Camp hill 2015-04-10
r Thank you so much for your love and your kindness amma. Thank you so much for your grace and in thanksgiving for answered prayers. Amma, I pray for my meeting with gf today that he may agree to m8 and that you may please bless that date and time and make me succeed in my td. Thank you for your love and kindness amma. Amma, I pray for my c job and my visa that you may work things out for me. I value my job and really want to do well in it, so please be with me amma and help me with everything. Amma, thank you for your blessings with 508 and 550. Lorrd Jesus, Father Lord, Holy Spirit, appe, kaval malakhamre, kanyattunirappu muthappanmare, st antony appacha, st jude appacha kathu kollane. Please please please be with me and help me with everything. slo 2015-04-10
C R BABU Amma Velankkani mada I beg and pray with all humility to bless my daughter with French visa for her to spend holidays in France.Amma I beg for your mercy upon us. Kochi 2015-04-10
C R BABU Amma Velankkani mada I beg and pray with all humility to bless my daughter with French visa for her to spend holidays in France with her husband.Amma I beg for your mercy upon us. Kochi 2015-04-10
C R BABU Amma Velankkani mada I beg and pray with all humility to bless my daughter with French visa for her to spend holidays in France with her husband.Amma I beg for your mercy upon us. Kochi 2015-04-10
2015-04-10
Baalachandiran Kunaratnam,Canada, Amma please help to solve our current financial situation and also heal my shoulder pain. Canada 2015-04-10
vinu thomas Oh mother mary , thanking for your daily blessings upon me. Kindly strengthen me from inside to face the hurdles and obstacles in my life. Oh mary, you know our situation pretty much well. Be kind to have mercy upon us. KOCHI 2015-04-10
M. BANU Amma! please pray for my mama son's discipline and honesty. He must realize his fault and come back with me. He must marry me and live with me. Please pray for request Amma! Thalamuthunagar, Tuticorin-628002 2015-04-10
Banu mma! please pray for my mama son's discipline and honesty. He must realize his fault and come back with me. He must marry me and live with me. Please pray for request Amma! Thalamuthunagar, Tuticorin-628002 2015-04-10
Banu mma! please pray for my mama son's discipline and honesty. He must realize his fault and come back with me. He must marry me and live with me. Please pray for request Amma! Thalamuthunagar, Tuticorin-628002 2015-04-10
Banu mma! please pray for my mama son's discipline and honesty. He must realize his fault and come back with me. He must marry me and live with me. Please pray for request Amma! Thalamuthunagar, Tuticorin-628002 2015-04-10
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-10
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-10
jennifer Dear mother, Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless my avi n me good health, make us peaceful, free us of all worries, free us of all tension, good house, good increment good promotion. Mother please free avi n me of all worries n tension. Mother please bless avi n me of good health n job satisfaction. Mother please bless us sort our family dispute. Mother please bless my dad eternal peace. Mother please bless my family peace n happiness. Mother please bless my mom good health, mother please bless us good health full time maid. mumbai 2015-04-10
stephen c Dear People Of God, I wish to thank Jesus,Mother Mai and you people of God for all the Petitions, blessing,prayers requests, granted during the week. Thank you Jesus Praise you Jesus Love you Jesus, Stephen a servant of Jesus. Mumbai 2015-04-10
LAVI MOTHER MARY BLESS ME AND MY FAMILY. MOTHER PLEASE PRAY FOR MY WORK.AMEN UAE 2015-04-10
liji Amma,please pray my brother studies and semester examinations to get good mark pta 2015-04-10
liji Amma,please pray my brother studies and semester examinations to get good mark pta 2015-04-10
your devotee Amma,please improve our financial problems also please answer all my request... pta 2015-04-10
your devotee Amma,please improve our financial problems also please answer all my request... pta 2015-04-10
Kavitha Henry Mother mary pls have mercy on me amma know my husband is ok and he have to walk soon amma pls help me amma iam facing lot of problem I would not able to control my problems iam facing so much of problem amma pls help me amma I dono what to do amma help me in the money matter amma still I have not given the rent also amma office and house and the interest having so much of problem amma not having the money only what to do amma tell me amma if you have love on me give me the correct answer who have did wrong to me you have to show them big big result amma how much iam suffering your seeing every thing right amma but if your true to me you have to should them how much iam suffering like that more than me they have to suffer amma pls bless me and help me ammapls give me the money amma to pay the rent amma pls bless me I have to take the admission amma don't leave my hand amma pls help me amma iam not able to cry amma pls be with me and help me amma having lot of debits amma pls be with me and help me amma no help is there from any one having lot of problems only amma no business in the office and your seeing all the problems to me amma pls help me amma Amen. Bangalore 2015-04-10
christyu dear ma, i have no words to ask. we are in such a situation. tension i work, tension in family, tension due to lack of money.dear ma hear my prayer. you know everything. no need to repeat. dear ma wwe are trying a lot to come up. but in vain. a lot of money we had spent in advt to achieve our goal. what happend to us we don't know. dear ma don't be too late. we have to come up. give us one way or another. dear help us now. pray for us to your son. dear ma your prayers will be heard. dear ma pray for us for the sale s of the house in vellamadam and give us new works to live. dear ma remove all unwanted things from us. pray for us pray for us. pray for us. we are in a sinking stage. hold our hands ma. please.... ngl 2015-04-09
meghkasathish mathave nanni, nigalude prathanude balmai 8varushthinusesham oru aan kutti jenichu yentre bartavinu oru jolium kitti mathave nanni. kochi ernakulam 2015-04-09
meghkasathish mathave nanni yesuvenanni,nigalude prarthathnude balmai 8varushithinusesham oru aan kutti jenichu yentre bartavinu oru jolium kitti yesuve naani mathve naani kochi ernakulam 2015-04-09
meghkasathish mathave nanni,nigalude prarthanude balmai oru aan kutti jenichu yentre barthavinu oru jolium kitti mathave naani kochi ernakulam 2015-04-09
meghkasathish mathve nanni, yesuve nanni, nigalude prarthanude balami 8varushathinusesham ru aan kutti jennichu yentre barthavinu oru jolium kitti yesuve nanni ,mathave nanni. kochi ernakulam 2015-04-09
meghkasathish mathave nanni yesuve naani nigalude prarthanude balami oru aan kuuti jenichu yentre bartavinu oru jolium kiiti yesuve nanni mathave naani kochi ernakulam 2015-04-09
meghkasathish mathave naani, nigalude prarthanude balmai oru aan kutti jennichu tentre barthavinu oru jolium kitti.mathave nanni. kochi ernakulam 2015-04-09
meghkasathish mathave naani,yesuve nanni.nigalude prarthanyude balmai oru aan kutti jenichu yentre barthavinu oru jolium kitti yesuve nanni,mathave nanni. kochi ernakulam 2015-04-09
kiran Dear Mother. Please bless my child and cure him soon mother. He has fractured his elbow and suffering from pain. Please mother do miracles and remove pain from his hand mother. He is suffering a lot mother. there is nothing impossible from you mother. I beg you mother heal him completely mother. bangalore 2015-04-09
meghkasathish mathave nanni nigalude prarthanyude balami oru kunhine kitti yentre barthavinu oru jollium kitti. mathave naani. kochi ernakulam 2015-04-09
meghkasathish mathave nanni yesuve nanni nigalude prarthanude balamai oru kunhine kitti yentre bartavinu oru jolium kitti .yesuve nanni, mathave nanni. kochi ernakulam 2015-04-09
M PUNNIADHAS Holy mother, my son is suffering with mental agony. I pray you kindly help him to come out from this situation. Amen. chennai 2015-04-09
Anusha kanna Dear mother first of all thanks to Jesus bcoz he gave me a good parents and pray for my education and also for my life partner he should be prayerfully well behaved person and I want to meet him in presence of u that means in front u r church please pray for my wish mother.... Please please... Amen guntur 2015-04-09
M. BANU Amma! Please give discipline and honesty to my mama son Sahul. and he must marry and love me. He must realize his faults and come back with me. He must live with me. Indru ithai patri pesaporathu nallapadiya mudiyanum. Give strength to my victory. Thalamuthunagar, Tuticorin-628002 2015-04-09
shierly Dear Mother Mary, I thank you for everything you had done for us.Please help my daughter in her studies as she doing B.Ed,but she is suffering from severe migrain problem and some mental issues,so she could not concentrate in her studies. please be with her and help her to pass the course and get into a good job. And also my son is in a confusion with two jobs in mumbai and he cannot come to correct dicision that which is the best for his future. please be with him mother and please select for him the right job for his future.I onceagain thank you mother for you had done good things for us west tambaram 2015-04-09
SM Please forgive me ma for hurting my real ma... Please give me breakthrough in RS.... CN 2015-04-09
2015-04-09
neha please amma shobu and i get married please i clear dha/moh in my first attempt and i get good job there and my acidity problems get resolved please bagalkot 2015-04-09
shinu Mother Mary we thank you for considering us & get us way forward.Help us to close it with your grace .Help us to get this job for my wife. She has desperately reqd this & we will come to your church when you will call us.You always gave us what we desire when we planned for visit.Help us all manpower always with your grace & faith.Amen Bhopal 2015-04-09
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-09
Vinay Narisetty Oh my mother help me in all this issue I am facing in over Job & family's. Protect my job and give me will power and help me without getting any issues. Protect me from the people who are using political mind and help me from them mother. Forgive all my sin what I have done. Please keep my job protected and help over family with your full of love. Please help me for getting I 140 approval. chicago 2015-04-09
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma.bless specially rishika for good health. varahapatnam 2015-04-09
Clara Marian place prayer for me and my son boc we r staying together boc am working for her am working antil 8,9 years in abrod, but i dnt nt maked my owen house or my son ,s fucher i lose evry ting but i dnt wnt lose my son, i wnt make owen house and good fucher of my son just plz prayer for me and for my son isreal 2015-04-09
r Amma, I pray for your grace and your kindness. Plesae be with me and please make things alright. Amma, I pray that I be able wo attend it, that the plans we laid out after asking for your grace work out. Please please please help me amma. Please be with me amma as I meet df today. Please bless our discussion and please lead us to positive outcomes. Thank you so much for every little blessing that you have shown on my life. Please continue to heed to my prayers. amma, please do not let me lose my job which I have worked so hard to get. My life seems to be in the hands of others. Kathu kollane amma. Please let no harm come. slo 2015-04-09
R Dear mother I beg you heal this little child who has bubbles on his skin only 7 yr old heal him also his parents touch the medicines and the dr too. lord touch him we soak him in your precious blood also lord help cl to get his driving licence open our eyes to see the paper show us the same in front of us with out this doc we cannot go anywhere help us to find only you can help us. help our rent not to increase and help us in our financial aid mother. help our children to see well touch their eyes and vision thank you for the miracle clay has got many friends and this is possible only with you help me to do a lot of exercise and loose weight I beg you lord. help us at our work place m 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my sone isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
clara hello.bother and sister prayer for me and my son we are not staying together so long long timebc my work am working antil 8,9 year inabrod but i cnt make my owen house or i cnt make a good life for my son, plz paryer for me nd for my son isreal 2015-04-09
jikku ammae maathavae.. sankadam sahikkan patanilla ammae.. jeevithathil othiri thettu pattiyittundu ammae.. thiruthan pattaatha athrayadhikam thettukal.. ammae.. ellaarum ennae ettaechu pokuva.. ariyilla ammae.. athraykum snkdam ondu.. eniku avaleyenkilum thannudae ammae.. othiri estava,... athonda... ariyilla ammae.. enthu cheyyanam ennu.. enikku oru vazhi kaanichu tharanae ammae.. pls.. ammae.. pls.... kerala 2015-04-09
shiny sunny kindly pray for my son Snehil sunny to be selected in railway exam he appeared. Bhilai Chattisgarh 2015-04-09
jeena thank you mother for giving back my happy family..to return my father from bad habits.mother plz help me in my entrance exam..am getting tensed..plz do be with me...make my dreams cone true..realize me from my dilemma... kerala 2015-04-09
W Thomas Please bring healing to Natalie Wells who is 9 years old and having intestinal problems. +W Thomas Wells USA 2015-04-09
LOURDAMA DAWSON Ma,please pray for me and my dad reach your shrine on coming july 2015. please let us have a comfortable journey and reach you and pray. Pray to have a better health and life for my dad. please Ma help us. Amen malaysia 2015-04-09
LOURDAMA DAWSON Ma,please pray for me and my dad reach your shrine on coming july 2015. please let us have a comfortable journey and reach you and pray. Pray to have a better health and life for my dad. please Ma help us. Amen malaysia 2015-04-09
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house good increment good promotion. Mother please bless us sort our family dispute. mother please bless my family peace n happiness. Mother please free avi n me of all worries n tension. Mother please bless avi n me good health n job satisfaction. Mother please bless my mom good health. mumbai 2015-04-09
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-09
vinu Oh mother mary ,Thanking for your daily blessings for us.Thanking for your care , benevolence and support. Oh mother mary, i am really in a confusion regarding my job. Kindly do give necessary guidance in choosing the best one . KOCHI 2015-04-09
Devotee Mother Mary Please pray for me ,remove all the problems that Iam facing right now , secure my future Devotee USA 2015-04-09
sherin Ente...mathave...njan othri vedanikunnu...physically and mentally...mathave...ente asugam matti tharaneme...fissure enne vallathe vedanipikunnu...enk e vedana sahikan patunila..mathave oru family life um kunjugalum njan agrahikunnu...ente e asugathil ninnum viduthal nalki nalloru family life enk tharaname...fincial tight ulla enk government il job nalki jeevikan ulla vazhi kanichu tharame....amme...ente...ipolum njn vedan anubhavikunnu...surgery koodathe e nimisham thanne enk soukyam tharaname...amme mathave...enne kai vidale...aa palliyil nerit varanam ennu njan agrahikunnu...ente asugam mari nalloru life il ayit avide varan ulla anugraham tharaname...amme....enne sweekarkaname....njan viswasikunnu njan sugapettu ennu kottayam 2015-04-09
Tarika Selvam Velankanni Amma Thanks for all your blessings. Bangalore 2015-04-09
Sandeep Holly Mother Mary Thank you so much for making normal delivery to my wife. Praise the lord. Chennai 2015-04-08
jojibabu amma mother i beg t u amma ur loved foots amma in the neame of jesus christ i beg t u amma ur wish amma not my wish amma please amma mother i beg beg beg beg beg beg beg beg beg beg t u amma i want ur mercy amma karuna mma nenu last six months nundi strugule avvutunnau amma health probulem amma suffering ammatody i will go to doctor amma antha emi lekiunda chudu amma medicine tho clear and heal amma who r suffer like me mma i beg t u amma ur wish amma please amma forgive amma my sins amma i beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg beg t u amma ur wish amma touch and heal amma mother amma amma amma amma amma amen.karunichu mary matha saranichu mary matha amma saranichu mary matha amma neeve dikku talli amma please amma i beg beg beg beg beg beg beg beg beg beg t u amma ur wish amma not my wish amma please amma i beg t u amma ur wish amma amen. hyderabad 2015-04-08
Alphy Ente Amme njan ennu ninnodu apekshikunnathu ente milankuttanu vendiya, avan nannayi ezuthane,amme avanu pencil kondu nannayi ezuthuvan sadikunnilla,amme nee avane ezuthuvan sahayikane,amme ente monu nannayi ezuthuvanum padikuvanum vayikuvanum ulla kazhivu kodukane amme, njan 9 wenesday upavasichu pray cheyam amme,ente monu nannayi ezuthuvanum padikuvanum sadikane amme, ente e apeksha nee ninte thirukumarante munpil samarpikane amme adutha varsham avan 1 st il akum amme, avanu ella vida anugrahavum nee kodukane amme amen mumbai 2015-04-08
jhonson anthony Dear Mother i apply bank loan to start restoran business and solve other matters as well. please bless me with the begining i need your guidance help me to each and everyone mother as brother rayappan want to go back to home town.Brother Zakarias need pay loan to never did. I have other issue to solve guide me and mary savarimuthu she need your help and blessing too. Victoria need your touch mother heal her eye to easy on her education and relationship with me and mary to get out from her mouth what issue related education and personel. Protect the children william and Victoria fill with Holy spirit unity us with one family is your will to be done help us financial and solve problem and personel issue give us happiness, peace and joy, shower of your love we need to come and visit you mother in india please grant your amazing blessing and protection for Amala Ventures Sdn Bhd to run the business with your guidance and protection amen amen amen i ask and pray in your name mother amen Kuala Lumpur Malaysia 2015-04-08
Roche Victor Maria Doss Nandri Madhavee, Amen Chennai 2015-04-08
jj Dear mother please improve our financial situation also please answer all my requests. India 2015-04-08
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-08
M. BANU Amma! please give discipline to my mama son Sahul. and he must marry and love me.He must realize his faults and come back with me. He must live with me. Thalamuthunagar, Tuticorin-628002 2015-04-08
M. BANU Amma! please give discipline to my mama son Sahul. and he must marry and love me.He must realize his faults and come back with me. He is my life. He must remember of me.He must live with me. 626-Samirviyas nagar, Mappillaiyurani post,Thalamuthunagar, Tuticorin-628002 2015-04-08
M. BANU Amma! please give discipline to my mama son Sahul. and he must marry and love me.He must realize his faults and come back with me. He is my life. He must remember of me.He must live with me. 626-Samirviyas nagar, Mappillaiyurani post,Thalamuthunagar, Tuticorin-628002 2015-04-08
daughter Please pray for me mother, please help me on the work front , you know of all the office politics and the worthlessness i feel, mother help me please, help me , i need your help to revive me and to make my office front better . Please mother help the ADC to realise my worth. adf 2015-04-08
LOUIS PUSHPARAJ Mary matha, i am suffered from kidney stone illness and with your support and help i got quered, thanks for blessing and wonderful support to my family on everyday, I request same blessing with my family members and all neiberour for good health and financial in further chennai 2015-04-08
Bernadine jayanthi Family peace,forgiveness for sins,children's health,studies Coimbatore 2015-04-08
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-08
Suresh Thanks Amma for praying for us. Kushi is not feeling well. She has got cold and cough. Please pray for he Amma. Please pray for my mother Bangalore 2015-04-08
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-08
suresh Dear Mother , Please pray for us to be able to sell the land in India in a good price , so that our house work can go uninterrupted and finish soon , selling the land will reduce our financial burden a lot , if it sells for a good price .Amen aud 2015-04-08
sasikala.j o mother please bless me for a good job and for job and please bless my family members to have a good health. neyveli township 2015-04-08
sasikala.j o mother please bless me for a good life paetner and for job and please bless my family members to have a good health. neyveli township 2015-04-08
sasikala.j o mary mother this is the prayer request for my marriage to give a good life partner neyveli township 2015-04-08
r Amma, please be with me for my p today. Please help me do well and be confident. Amma, I pray for our t plans. I am sorry for the sin that I did yesterday, I deeply regret it and I will never do it again. You can hold me to my word amma. I promise. Please do not punish me. Amma, I pray for my job, visa and degree. I pray that you be with me and help me with everything. Father Lord, Lord Jesus, Holy Spirit, appe, kaval malakhamare, kanyattu nirappu muthappanmare please please please be with me and help me with everything. Kathu kollane amma. Please be with me amma. slo 2015-04-08
anita shukla Mother plz bless me so as to get good price for my property and and plz help me in getting another good house. Rajkot 2015-04-08
Sandeep Holly Mother Mary Thank you so much for hearing my prayer and blessed with child. Help me in getting the leaves approved without any issues and go to India and enjoy with my new born. Thanks Chennai 2015-04-08
2015-04-08
S THIYAGU Mary Mother, please give wisdom, knowledge, power, faith to my beloved son T Akash .Help him to lead a disciplined and successful life. Please help him to follow your words and way. Bangalore 2015-04-08
Sunil soren Oh our loving mother and mother of lord,Please pray for my child who is suffering from severe abnormal disease.He is now two years old but still he is not sitting nor walking .he also not speaks,his activities is slow his mind is also slow.His health is not well.we are very anxious for him..we contact many doctors but not avail . Oh mother please pray for him to living Jesus.so that he might come out from it. Sahibganj 2015-04-08
Sunil soren Oh our loving mother and mother of lord,Please pray for my child who is suffering from severe abnormal disease.He is now two years old but still he is not sitting nor walking .he also not speaks,his activities is slow his mind is also slow.His health is not well.we are very anxious for him..we contact many doctors but not avail . Oh mother please pray for him to living Jesus.so that he might come out from it. Sahibganj 2015-04-08
jikku ammae.. maathavae,,, enikku avalae othiri estava... enthina maathavae veendum enganae okkae.. ellaam marannu erikkuvayirunnillae... veendum... sankadam varunnundu ammae.. othiri sankadam varunnundu... i really miss her ammae... enikkariyam njangadae kallayanam 1% polum nadakkan chance ella ennu... but ammae... enganaeyenkilum nadathi tharanae... ellaam entae kozhappam kondallae.. enikkariyam .. but ammae.. i really love her.. pls ammae... kerala 2015-04-08
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-08
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. Mother please bless avi n me good health, make us peaceful, free us of all worries, free us of all tension good house, good increment good promotion. mother please bless my avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. mother please bless my dad of eternal peace, Mother please bless us sort our family dispute. Mother please bless my family peace n happiness. Mother please bless my mom of good health. MOther please bless my family good health. mumbai 2015-04-08
M. BANU Amma! please give discipline and honesty to my mama son Sahul. and he must marry and love me.He must realize his faults and come back with me. He must live with me. Give strength to my victory. Please pray Allah Thalamuthunagar, Tuticorin-628002 2015-04-08
M. BANU Amma! please give discipline to my mama son Sahul. and he must marry and love me.He must realize his faults and come back with me. He must live with me. Thalamuthunagar, Tuticorin-628002 2015-04-08
H.Rojes Dear Mother thanks for all of happiness and then i have a lot of problem in my studies..i have API 510 exam it will very difficult for me...i don't know whats happen? mother please pray for me & pray for my studies and work ..pray for Ginolin 10 th EXAM.thanks mother tirunelveli 2015-04-08
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Please give her strength and determination. Lord have mercy on us all, Amen. Malaysia 2015-04-08
r dear mother I beg you help cl to find his driving licence mother I soak this rquest of mine help me mother let it be in the house keep it safe under your holy mantle I beg you pls intercede with yr son to find the licene as without this we are dead help jesus I soak this request of mine with yr precious blood don't let us down mother help us to find this document. m 2015-04-08
meghkasathish mathave naani ,yellavarukum naani nigalude prarthanude balamai 8varushathinusesham oru aan kuttijennichu yentre bartavinu oru jolium kitti mathave nnani kochi ernakulam 2015-04-08
Kavitha henry Mother mary pls have mercy on me amma pls help me amma how many times to ask you the help pls bless me and I need money to pay my rent and house rent amma pls bless me and help me amma having lot of money problem cant able to control amma there is no business also in the office very very low business amma pls help me to get the business adjust the house rent and the office rent and interest amount amma pls help me and bless me amma pls have mercy on me amma and support me I want the business give me money amma giving me so much of problem amma I dono were all this problem are going to be end amma having lot of debit problems amma pls solve me and help me amma pls soon show me one good shop for the driving school amma pls soon I have to shift from her amma pls bless me and help me amma love me amma your not having faith on me to help also amma still iam here pls give me the business amma no baddy knows how much problem iam having amma pls bless me and help me amma Amen. Bangalore 2015-04-08
meghkasathish mathve naani yesuve naani .nigalude prarthanude balami 8varushathinusesham oru aan kutti jenichu yentre barthavinu oru jolium kitti yesuve naani mathave nanni. kochi ernakulam 2015-04-08
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Give her strength and determination. Lord have mercy on us all, Amen. Malaysia 2015-04-07
r dear mother I beg you help my son to make new friends open some door mother let him take up the leadership given to him change him to become a good and mixing boy with other children and not to be a lonely boy.i beg you lord take care of our job help cl to get an increase and us too for our financial aid come to us mother we pray for peace mother stamp the satan and crush the evil out of this world spl towards christinas jesus we soak all the wrong thinking minds and people in yr precious blood lord take care of us help us to change our timings help the kids to study well restore their eye sight help my cas to put on wt and height too mother she is very short in her class. help them to eat well make the children strong in yr love I beg you for my son cl help him to mingle in the class make him a active child help them to go for chess or swimming classes open the financial door for us, help us to get an increase and dental too this year added in my insurance this is important mother as I am suffering from severe tooth problems also for my hair. take care of our parents lily aunty too heal her and montin moushie. help me go get some good biz in our section. help cl at his work place to get an increase or a beter job open some door for him mother m 2015-04-07
daughter Mother please continue praying for me, you gave the circumstances where i could speak, i request you mother to please help me to get a favourable talk regarding my work and capacity from my other senior officers , so that the present boss realises that i have knowledge and capacity to work. Please may my work speak and help me to feel that God is by my side. May those collegues who are trying to over take me and prove their work realise that God is above all . and He will never do unjust to those who believe in Him. I trust you mother please remain with me and my husband and our kids. May we be utilised for the glory of Gods name. Amen asdf 2015-04-07
MS P STELLA ROSE MALAR THIS IS SUNTOMMY FONT-Tamil md;ghd rNfhjuHfSf;F>vd; ngah; P.stella rose malar(M.E-CSE). vd; fzth; Mr.P.israel prabhu(M.Pham,Chennai). (2011-2015) 5tUlk;,ehq;f,uz;L NgHfSk; gphpe;J tho;e;J tUfpNwhk;.No child. ehq;fs; gphpe;J tho;tjw;F kdpjd; xU fhuzkhf ,Ue;jhYk;(kdpjh;fis Fiw$Wtjw;F vdf;F mjpfhuk; fpilahJ) rhj;jhdpd; Nghul;lk; kpfTk; mjpfkhf fhzg;gLfpwJ.,Ue;jhYk; jesus ¬šJ mjpfkhd ek;gpf;ifAlDk;, tpRthrj;Jld; mthpd; mw;Gjw;fhf fhj;J tUfpNwd; (Vndd;why; fztd;-kidtp cwT jesus nfhLj;j cld;gbf;if).Mjyhy; vdf;F gphpe;J tho kdjpy;iy.vdf;fhf n[gk; nra;Jf;nfhs;Sq;fs;(vd; fzth; vd;šJ ghrk; itf;fTk ;kw;Wk; vd; fzth; vd;Dld; Nrh;e;J tho;tjw;Fk; kw;Wk; vdf;Fk,; vd; FLk;gj;Jf;Fk; tpNuhjkhf tUfpw rhj;jhdpd; Nghul;lj;ij Kwpe;J XLtjw;fhfTk;, kw;Wk; xU ey;y Ntiy fpilg;gjw;fhfTk; nIgk; nra;Jf;nfhs;Sq;fs;).,NaR vd; tho;tpy; vy;yh mw;Gjj;ijAk,; vd; tpUg;gijAk;,ehd; ngw;Wf;nfhz;Nld;(je;J tpl;lhh; vd;w epr;raj;Jld;) vd;w KO tpRthrj;Jld; fhj;Jf;nfhz;L ,Uf;fpNwd;. Tirunelveli 2015-04-07
neha please mary shobu and i get married please his parents agree and mine too and i get dha/moh i my first attempt and i get a good job and my dad gets a promotion and my all gastric troubles solve please bagalkot 2015-04-07
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child, Mother please bless avi n me good health, make us peaceful, free us of all worries free us of all tension good house good increment good promotion good full time healthy maid. Mother please bless my dad of eternal peace. Mother please bless us sort our family dispute. Mother please bless my family peace n happiness., mother please bless avi n me of good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless my mom good health. Mother please bless us sort our family dispute. mumbai 2015-04-07
Sangeetha This is the prayer request for my daughter Ritika admission in school. we tried our best to get the school in our area. which is RC christian based school. we are hindu religion it is problem for us to get seat in that school. we are trying again to get admission. please kindly pray for us get admission. Pray for my child has to go to higher levels on getting good education and communication from that school chennai 2015-04-07
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-07
REEMA MOTHER MARY PLZ HELP ME TO GET A GOOD JOB IN DUBAI I'M IN VISIT VISA ONLY 20 DAYS REMAINED MOTHER MARY PLZ HELP ME. MANGALORE 2015-04-07
r Amma, I pray for your grace as I take every little step in life. Amma, I pray for my prez tomorrow that I be prepared well and do well. I pray for focus and for confidence and for a plan. Amma, I pray for my t, my job, my visa and my degree. I pray that something may work out for today's 508 class that I may find a good partner. Amma, you are my hope for all good things. Please continue to take care of my baby and keep him safe, healthy and happy. slo 2015-04-07
Anita Sweet Mother, please grant that mum, me & my daughter can live together by ourselves with complete peace & freedom from our tormenter.Please solve also our financial & family problem. Thank you for all your blessings & messages at Medjugorje. UK 2015-04-07
Baalachandiran Kunaratnam,Canada Amma please help me to heal my shoulder pain and also my financial situation nust be changed with your divine miracle. Canada 2015-04-07
chioma Green contesting elections to be governor this saturday. Please pray that he wins and also favours us. His name is Nyesom Ezebunwo Wike and our names are kinikanwo and Chioma Green. Thank you and God bless you. Regards, Green Chioma. nigeria 2015-04-07
Dominic Subrata Debbarma MA... PLEASE LET MY DAD'S PENSION BE RELEASED BY YOUR PRAYERS & LET THERE BE NO HURDLES OF ANY SORRY FROM MEN.LET HIM GET MORE THAN HE DESERVE BECAUSE YOU THAT HE TRUST YOU A LOT...LET HE GET MORE THAN 70 LAKH'S IN A SHOW WITHOUT ANY HURDLES AND SOON...AMEN BANGALORE 2015-04-07
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN Hyd 2015-04-07
Baby Velankanni Mathave, Kindly be with my son, guide him ,bless him and make him perform well so as to fulfil his wishes, during upcoming examinations. Kindly take care of him. Please intervene for granting his wish.Everything is possible with mother's help and intervention.I will come to Velankanni shrine.Amen. Kottayam 2015-04-07
A Amma mother of jesus ..i heard tht somethng wrong news frm others hpe ths wll not hppen...and hope he wlll talk to me frm hs partAmma plss help mei dnt knw amma hpe he wllgveme a reply wht i asked him amma help me i m in trouble..... kerala 2015-04-07
Caroline Nadan Dearest Mother Mary of Good Health, please ask Lord Jesus Christ for me to heal my mum miraculously if its God's will and to protect her always. Please give my mum strength and determination. Lord have mercy on us all, Amen. Malaysia 2015-04-07
M. BANU 4th day prayer Amma! 20 days-ikkul en manathai kulappi en mama son en parisuthathai keduthuvittan. avan ippa ennai kalyanam panna matten engiran. avanal thinamum naanum en kudampamum kaneer vadithu kondirukkirom.Amma! thirunthi varavendum. Ennai Kai vidamal irrukka neengathan Allahvidam dua seiyanum Thalamuthunagar, Tuticorin-628002 2015-04-07
jennifer Dear Mother, Thank you mother very much for this day and for all the favours granted. Mother please bless us blissful happy healthy married life. Mother please bless my son good health, make him peaceful and normal child. mother please bless avi n me good health, make us peaceful,free us of all worries free us of all tension good house, good increment, good promotion. Mother please bless us sort our family dispute. mother please bless my mom of good health, Mother please bless my family peace n happiness. Mother please bless my dad eternal peace. Mother please bless avi n me good health n job satisfaction. Mother please free avi n me of all worries n tension. Mother please bless us get a good full time maid. mumbai 2015-04-07
Michael Ma, thanks for all your blessings and graces you have showered on me and on my family. Ma, You are great and please keep us in your mercy and grace always and Ma, Please help my daughter and you correct all her papers. thanks Ma. auh 2015-04-07
Sandeep Holly Mother Mary Please be kind to my wife.She is admitted in hospital for delivery. Help her in getting normal delivery. Thank you Chennai 2015-04-07
J.Dominic Vijay Kumar Dear Mother Mary, Please bless me and my family with good health, good wealth, peace of mind and protect us from all evils,dangers,accidents and please forgive our sins and forgive those who sin against us. Mother Mary again am begging you fro my job and please give me better job I want to move out in good way, I don't want to get insulted or humiliated or thrown out of this company, mother Mary you have done so much of favor and shown miracles on in my lie ,but why now am not able to get better job ,am really struggling so much ,there is no future in this company ,its only money that to only for people who are close to my MD and my Boss, you know everything what I happening in my life please save me and protect me from this mess, I want complete this villa's project tin proper way and come out of this ,my MD and my Boss will to spare for this blunder I have done ,am really scared to send the Indent for approvals ,my savior I need you come to my aid and protect me and forgive me for this mistake and show me way fro my survival and where will I go if something happens and what will happen to my future my family and all the comforts which is given by you, my savior why is my life this this is totally because of my irresponsibility ,please give me last chance to I'll never repeat this mistake and please I beg you to show mercy on me and my family ,because of me I don't want my family to be on roads and next month is my daughter's first hoy communion ,my father is coming here please bless us and be with us so that everything goes well without any issues and problems. Mother Mary please come to my aid and forgive my sins and forgive those who sin aganist us and please save my job and gie me better job and show me way fro my survival pls don't let me down in front of anyone ,I'll bow only front of my lord Jesus and you ,pls give me strength and confidence to overcome all my problems and give the best to my MD and my boss. Please bless my relationship with my boss and my team and my MD who is paymaster and always bless him with good mood so that he doesn't insult me or shout at me in front of anyone and pls bless my relationship with all my collogues my senior and team mates pls bless me and give me strength to work hard and get all the pending project works to be completed and mother Mary me and my family thank you for getting my daughter's passport on time, pls show me way so that I can get better professional company where my self-respect is has some value. In your name am starting my day pls bless me and protect me from all legal issues, problems ,and pls give me success and prosperity in life and good career growth. O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, O Mary, virgin before childbirth keep me pure in soul and body, St. Anthony beloved of god and man pray for us. Every threatening danger vanishes at thy prayer. Amen, Rgds, J.Dominic Vijay Kumar Delhi 2015-04-07
Anita Ferreira Please pray for my son, his name is Shaun Ferreira. He is very weak in studies and has attempted 3 times to clear his H.S.C exams but with no success. Please pray for him to get success in his studies and get a good job. Please pray for peace in our house because there is always tension and fights between shaun and his father regarding this and they do not speak to each other most of the time.Please pray for our Mother to give them peace and make them loving and caring towards each other. Mumbai 2015-04-07
RUBY JOSEPH PLEASE PRAY FOR MY SON RYAN JOSEPH WHO IS HAVING RECURRENT SEIZURES EVERY 3-4 MONTHS DESPITE OF INCREASING MEDICATION.HE IS GOING TO BE 4 YRS IN THIS AUGUST newyork 2015-04-07
r Thank you so much for your love and kindness amma. Thank you for your grace. Please help me get back on track with studies and my graduation. As I make my submission to gf, please make him approve of my work and not find fault with it. Father lord, lord jesus, holy sir it, appe, kaval malakhmare, kanyattunippu muthappanmare, st antony appacha, st jude appacha please please be with me. slo 2015-04-06
daughter Mother thank you for all your grace.... please pray for me on the office front asdf 2015-04-06
asha MATHAVE!!!!help my daughters Alina and Alisha to write the exams very well and to score good marks Bless our children ,,I beg you because they are your kids kerala 2015-04-06
asha bless Alisha to get admission in Rajagiri if it is your will i will always be indebted to you kerala 2015-04-06
sp Mother please take care of me and my baby in my womb as we go to attend the meeting. I cannot avoid it even if i am advised bed rest. Mother please make things easier for me and my family to survive in this new place.May Your Holy Angels protect and guide us, defend us against all evil. Mother i place all my worries unto Your feet.Hail Mary. hdy 2015-04-06
Anon Blessed Mother Mary, ever Virgin, I live day by day in Your Faith, Hope & Love. Please do not forsake my loved ones. Amen. --- 2015-04-06
daughter Mother please help me to get to do work in office, my collegue avoids me and keeps me away from work, please help me to get work and do it well. Please help me to get worth and recognition asdf 2015-04-06
mahesh Dear amma please bless my family.give good health to vijaya kanna rishika amma and nanna.bless pond amma.give me government job amma.thankyou amma. varahapatnam 2015-04-06
sm Ende Mathave Mathave please intercede for us. I had 2 miscarriages .please bless us iwht healthy conception and healthy baby.please intercede for us,Mathave tomorrow doing the procedure.please bless us with a healthy conception and healthy pregnancy.make the follies grow right and lining. Thanks Mathave for all thy grace and intercessions. us 2015-04-06
b Dearest mother pray to your son Jesus to rescue my husband from the bondage of extramarital affair. He seeks forgiveness and wants to come out of this relation. Pray for Jesus mercy and grace on him. I also fervently pray for the other woman that she may be filled with the Lord's grace to forgive my husband and release him from this bondage as she is finding it difficult to leave him and expects him to marry her. Pray that Jesus may comfort her and bless her with peace so that she moves on peacefully in her life. Pray that she does not cause any harm to herself. May Jesus bless her and pray Jesus restores and bless our marriage. O mother please intercede to Jesus Mumbai 2015-04-06
b Dearest mother pray to your son Jesus to rescue my husband from the bondage of extramarital affair. He seeks forgiveness and wants to come out of this relation. Pray for Jesus mercy and grace on him. I also fervently pray for the other woman that she may be filled with the Lord's grace to forgive my husband and release him from this bondage as she is finding it difficult to leave him and expects him to marry her. Pray that Jesus may comfort her and bless her with peace so that she moves on peacefully in her life. Pray that she does not cause any harm to herself. May Jesus bless her and pray Jesus restores and bless our marriage. O mother please intercede to Jesus Mumbai 2015-04-06
Baalachandiran Kunaratnam,Canada Amma, please make a miracle to solve our current financial troubles and Amma please heal my shoulder pain with your divine son's miracle. Canada 2015-04-06
kerina noronha Dear ma I kerina noronha come b4 u to aske u To bless my hubby with good Health an Suessuse be with him in ever think bless Him ma. An keep ur blessed hand on me also Bless me with twins 2 boys an complet My family. With this fath I come to u. goa 2015-04-06
Merlyn 1.I am suffering from acne problem for the past 1year. I tried all the medications given by the dermatologist. But it does not give any satisfactory results. I m so frustrated to look at my face and feeling depressed. I request to pray for my acne to get clear from my face. 2.My dad is suffering from leg pain since a couple of weeks. Please pray for him. 3. My friend's mom has undergone brain surgery and has not revived her conscious yet. Please pray for her to recover fully. UAE 2015-04-06
2015-04-06
H.Rojes dear mother now i am going to see my API 570 Result please stay with me i want pass my result please come with me amma please if you with me during my result i should be pass tirunelveli 2015-04-06
Lizy AMME THAYE VAILANKANNI MATHAVE PLEASE HAVE MERCY US AND BLESS AND HELP US IN ALL OUR NEEDS AND WORKS AMME WE ALL FAMILY MEMBERS THANK YOU SO MUCH FOR BLESSING US THE WHOLE LAST MONTH AND PRAY TO YOU TO BLESS US MORE THIS MONTH AMME HELP ME TO COME OUT OF ALL MY PROBLEMS AND MAKE ME TO CLEAR ALL MY DEBTS AND PROTECT US FROM ALL THE EVIL SPIRITS AND BE WITH US ALWAYS AMME HELP ME IN BUYING THE HOUSE AND BLESS MY SON AND ALL THE CHILDREN WHO ARE GOING TO WRITE THEIR FINAL EXAMS FROM TODAY AND BE WITH THEM ALWAYS AMME HEAL EVERY SICKNESS OF US AND GRANT ALL OUR PETITIONS IN JESUS NAME I PRAY AMEN